The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2503: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Uncharacterized N-acetyltransferase YtmI
Translate Function Assignments



Context on contig NC_009641 from base 2525722 to 2536402 (10681 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2499 2526699 2525722 978 -       4: 4 5 7 6   Uroporphyrinogen-III methyltransferase (EC 2.1.1.107) gene_name|cysG, locus|NWMN_2298, protein_id|YP_001333332.1, gi|151222510, geneID|5332196
2500 2527004 2526690 315 - -10     3: 2 1 3   Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4) gene_name|nirD, locus|NWMN_2299, protein_id|YP_001333333.1, gi|151222511, geneID|5331849
2501 2529413 2527008 2406 - 3     3: 2 1 3   Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4) gene_name|nirB, locus|NWMN_2300, protein_id|YP_001333334.1, gi|151222512, geneID|5332205
2502 2530210 2529479 732 - 65     1: 4   Sirohydrochlorin ferrochelatase (EC 4.99.1.4) gene_name|nirR, locus|NWMN_2301, protein_id|YP_001333335.1, gi|151222513, geneID|5332204
2503 2530976 2530440 537 - 229         Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232         formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2503 Uncharacterized N-acetyltransferase YtmI
MTKTMIRLASEQDAEKLQQLMHEAFTPLRELGIDWPSVNANLDAVKENIDKNTTFVMTID
DEIISTITVRYPWGSVKSISGYPFVWWFATNPEYEGKGYGSQLLTYVEEAFLRDTLKSAA
VTLGTSARLHPWLLKIYEKRGYEIYSEHENDDGDLGVIMRKVLIPERFDETILGQPPF

MD5 = ae1812f83161067d0c5e290d922804da


  DNA Sequence

>fig|426430.8.peg.2503 Uncharacterized N-acetyltransferase YtmI
atgacaaaaacgatgattcgactcgcaagtgaacaagatgcagaaaaattgcaacaactc
atgcatgaagcatttacgcctctaagagaactaggtattgattggccttcggttaatgct
aatttagatgctgttaaagaaaatatagataaaaatactacatttgtcatgacaattgat
gatgaaattatatctacgattacggttagatatccttggggaagtgtgaaaagtatttcg
ggttatccttttgtctggtggtttgcgacaaatcctgagtatgaagggaaaggctatggt
agccaattacttacttatgttgaagaagcatttttgcgagatacgttaaagtcagcggca
gttactttaggtacatctgcaagattgcatccgtggttacttaaaatttatgaaaaaaga
ggttatgaaatatacagcgaacatgaaaatgatgatggcgatttaggtgtgatcatgcgc
aaagtattgatacccgagcgctttgacgaaacaatattaggccaaccaccattttaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2503 Uncharacterized N-acetyltransferase YtmI
ctctatgcaattcaaaggcggcttaacaaaggcattcttcatagcttgtggtgtcgtggt
ctttgtatacatgggatatgagcacgttgtgttcaatgcaggtctatatgcaggtatggt
attctttaaccttgatgcagtttcatggttacacgttttaaaaaatatcgtttttgcttt
cttaggtaactttgtcggtggcggtatttttgtaggtctcgtttatgctttcttaaatgg
taagcgtaatcgtttagagcaacaataattaagatgtagtgattaaatagcgtaacaatg
aatcattcttccaaaccattcatgaatttgaatggttttttacgttgagagagtaatttt
taataagtttcatgagagtattggtgtattcagatgaagcatactttctgacatgtgata
aatttattgatacactttgatggatatttattttaaaaataaaatatggttaaatcattt
aaaaaagagtggggattaatatgacaaaaacgatgattcgactcgcaagtgaacaagatg
cagaaaaattgcaacaactcatgcatgaagcatttacgcctctaagagaactaggtattg
attggccttcggttaatgctaatttagatgctgttaaagaaaatatagataaaaatacta
catttgtcatgacaattgatgatgaaattatatctacgattacggttagatatccttggg
gaagtgtgaaaagtatttcgggttatccttttgtctggtggtttgcgacaaatcctgagt
atgaagggaaaggctatggtagccaattacttacttatgttgaagaagcatttttgcgag
atacgttaaagtcagcggcagttactttaggtacatctgcaagattgcatccgtggttac
ttaaaatttatgaaaaaagaggttatgaaatatacagcgaacatgaaaatgatgatggcg
atttaggtgtgatcatgcgcaaagtattgatacccgagcgctttgacgaaacaatattag
gccaaccaccattttaagataataatatacactacaagcgaccgatatattaatgcttgc
tcaaataaatgttgagtagggattcatatatcggtcgctttttttgatttaacaaaaagg
gaaaatgtataaggaatatgcatgactacaggcatcagggaattccctgattttacatta
taatgtgattcttttcacaaaaacaaaatgatttggtatacaatacgtgtgaaagggttg
gtaaatgtgaatgggaatatcattgttgcacatggcatgaggcacggacgacagaatcaa
gcgttagaagcatttatttctgaattagtaaaagatgatatacatcactatgatattgcg
tttttagaaagtgagcatcaggatttagagacggtaatgacgacgttgattcaaagtggg
gttgaccattttaaaattgtaccattgctaatctttagtgcaatgcattatctcaaggat
ataccgaatatcgttcatgaaatgaaacgacggtatc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008080       F:N-acetyltransferase activity
GO:0008152       P:metabolic process
cmr|NT01SA2416 Staphylococcus aureus N315     acetyltransferase, GNAT family family
cmr|NT02SA2401 Staphylococcus aureus Mu50     conserved hypothetcial protein SA2190
cmr|SACOL2400 Staphylococcus aureus subsp. aureus COL     acetyltransferase, GNAT family
cmr|SAUSA300_2348 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB43492.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetcial protein
dbj|BAB58564.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAF68574.1 Staphylococcus aureus subsp. aureus str. Newman     acetyltransferase, GNAT family protein
dbj|BAF79269.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
fig|158878.1.peg.2402 Staphylococcus aureus subsp. aureus Mu50 FIG   Uncharacterized N-acetyltransferase YtmI
fig|158878.14.peg.2486 Staphylococcus aureus subsp. aureus Mu50 FIG   Uncharacterized N-acetyltransferase YtmI
fig|158879.1.peg.2275 Staphylococcus aureus subsp. aureus N315 FIG   Uncharacterized N-acetyltransferase YtmI
fig|158879.11.peg.2375 Staphylococcus aureus subsp. aureus N315 FIG   Uncharacterized N-acetyltransferase YtmI
fig|359786.13.peg.2566 Staphylococcus aureus subsp. aureus JH9 FIG   Uncharacterized N-acetyltransferase YtmI
fig|359786.3.peg.667 Staphylococcus aureus subsp. aureus JH9 FIG   Uncharacterized N-acetyltransferase YtmI
fig|359787.11.peg.2528 Staphylococcus aureus subsp. aureus JH1 FIG   Uncharacterized N-acetyltransferase YtmI
fig|359787.3.peg.1534 Staphylococcus aureus subsp. aureus JH1 FIG   Uncharacterized N-acetyltransferase YtmI
fig|367830.3.peg.434 Staphylococcus aureus subsp. aureus USA300 FIG   Uncharacterized N-acetyltransferase YtmI
fig|418127.4.peg.2206 Staphylococcus aureus subsp. aureus Mu3 FIG   Uncharacterized N-acetyltransferase YtmI
fig|418127.6.peg.2449 Staphylococcus aureus subsp. aureus Mu3 FIG   Uncharacterized N-acetyltransferase YtmI
fig|426430.6.peg.2231 Staphylococcus aureus subsp. aureus str. Newman FIG   Uncharacterized N-acetyltransferase YtmI
fig|450394.6.peg.2186 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Uncharacterized N-acetyltransferase YtmI
fig|451515.3.peg.2505 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Uncharacterized N-acetyltransferase YtmI
fig|451516.9.peg.2494 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Uncharacterized N-acetyltransferase YtmI
fig|452948.4.peg.552 Staphylococcus aureus 930918-3 FIG   Uncharacterized N-acetyltransferase YtmI
fig|505321.3.peg.188 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Uncharacterized N-acetyltransferase YtmI
fig|546342.3.peg.1508 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Uncharacterized N-acetyltransferase YtmI
fig|546343.3.peg.1350 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Uncharacterized N-acetyltransferase YtmI
fig|548474.3.peg.476 Staphylococcus aureus subsp. aureus TCH130 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553565.3.peg.2000 Staphylococcus aureus A5937 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553567.3.peg.779 Staphylococcus aureus A5948 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553568.3.peg.2734 Staphylococcus aureus A6224 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553571.3.peg.1523 Staphylococcus aureus A6300 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553573.3.peg.794 Staphylococcus aureus A8115 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553574.3.peg.1191 Staphylococcus aureus A8117 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553577.3.peg.231 Staphylococcus aureus A8796 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553580.3.peg.232 Staphylococcus aureus A8819 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553581.3.peg.2490 Staphylococcus aureus A9299 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553588.3.peg.2580 Staphylococcus aureus A9719 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553590.4.peg.1008 Staphylococcus aureus A9754 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553592.3.peg.547 Staphylococcus aureus A9763 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553594.3.peg.359 Staphylococcus aureus A9765 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553596.3.peg.1650 Staphylococcus aureus A9781 FIG   Uncharacterized N-acetyltransferase YtmI
fig|553601.3.peg.1898 Staphylococcus aureus A10102 FIG   Uncharacterized N-acetyltransferase YtmI
fig|585891.3.peg.2480 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Uncharacterized N-acetyltransferase YtmI
fig|644279.4.peg.2545 Staphylococcus aureus subsp. aureus 132 FIG   Uncharacterized N-acetyltransferase YtmI
fig|680649.3.peg.1360 Staphylococcus aureus subsp. aureus MR1 FIG   Uncharacterized N-acetyltransferase YtmI
fig|681288.4.peg.2429 Staphylococcus aureus subsp. aureus ED98 FIG   Uncharacterized N-acetyltransferase YtmI
fig|703339.3.peg.2390 Staphylococcus aureus 04-02981 FIG   Uncharacterized N-acetyltransferase YtmI
fig|93062.19.peg.2343 Staphylococcus aureus subsp. aureus COL FIG   Uncharacterized N-acetyltransferase YtmI
fig|93062.4.peg.2458 Staphylococcus aureus subsp. aureus COL FIG   Uncharacterized N-acetyltransferase YtmI
gb|AAW37225.1 Staphylococcus aureus subsp. aureus COL     acetyltransferase, GNAT family
gb|ABD22563.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABQ50205.1 Staphylococcus aureus subsp. aureus JH9     GCN5-related N-acetyltransferase
gb|ABR53298.1 Staphylococcus aureus subsp. aureus JH1     GCN5-related N-acetyltransferase
gb|ABX30374.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     GNAT family acetyltransferase
gb|EES94891.1 Staphylococcus aureus subsp. aureus USA300_TCH959     GNAT family acetyltransferase
gb|EES96606.1 Staphylococcus aureus subsp. aureus TCH130     GNAT family acetyltransferase
gb|EEV27054.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65385.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66118.1 Staphylococcus aureus A9719     acetyltransferase
gb|EEV71420.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV75856.1 Staphylococcus aureus A8115     acetyltransferase
gb|EEV77515.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV79385.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV83900.1 Staphylococcus aureus A5948     acetyltransferase
gb|EEV85219.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW45563.1 Staphylococcus aureus 930918-3     conserved hypothetical protein
gi|13702351 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetcial protein
gi|14248176 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147741907 Staphylococcus aureus subsp. aureus JH9 NCBI   GCN5-related N-acetyltransferase
gi|148268838 Staphylococcus aureus subsp. aureus JH9 NCBI   GCN5-related N-acetyltransferase
gi|149947362 Staphylococcus aureus subsp. aureus JH1 NCBI   GCN5-related N-acetyltransferase
gi|150375314 Staphylococcus aureus subsp. aureus str. Newman NCBI   acetyltransferase, GNAT family protein
gi|150394910 Staphylococcus aureus subsp. aureus JH1 NCBI   GCN5-related N-acetyltransferase
gi|151222514 Staphylococcus aureus subsp. aureus str. Newman NCBI   acetyltransferase, GNAT family protein
gi|156722852 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156980717 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2386
gi|15925392 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV2402
gi|15927980 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2190
gi|160369403 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   GNAT family acetyltransferase
gi|161510594 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   GNAT family acetyltransferase
gi|221138485 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   GNAT family acetyltransferase
gi|221141320 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   GNAT family acetyltransferase
gi|253314739 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_00910
gi|253726162 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GNAT family acetyltransferase
gi|253727877 Staphylococcus aureus subsp. aureus TCH130 NCBI   GNAT family acetyltransferase
gi|253730075 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GNAT family acetyltransferase
gi|253734182 Staphylococcus aureus subsp. aureus TCH130 NCBI   GNAT family acetyltransferase
gi|255007176 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_11925
gi|257788714 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794742 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840934 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257841681 Staphylococcus aureus A9719 NCBI   acetyltransferase
gi|257847418 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257851922 Staphylococcus aureus A8115 NCBI   acetyltransferase
gi|257854567 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257856476 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257861085 Staphylococcus aureus A5948 NCBI   acetyltransferase
gi|257862451 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258407422 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258422250 Staphylococcus aureus A9719 NCBI   acetyltransferase
gi|258439642 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258442801 Staphylococcus aureus A8115 NCBI   acetyltransferase
gi|258446499 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258450384 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451293 Staphylococcus aureus A5948 NCBI   acetyltransferase
gi|258455240 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259160540 Staphylococcus aureus 930918-3 NCBI   conserved hypothetical protein
gi|57285131 Staphylococcus aureus subsp. aureus COL NCBI   acetyltransferase, GNAT family
gi|57650945 Staphylococcus aureus subsp. aureus COL NCBI   acetyltransferase
gi|87128049 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162075 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2348
img|637093943 Staphylococcus aureus aureus N315 IMG   conserved hypothetcial protein
img|637100959 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637153156 Staphylococcus aureus aureus COL IMG   acetyltransferase, GNAT family
img|637888991 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|639109825 Staphylococcus aureus aureus JH1 IMG   GCN5-related N-acetyltransferase
img|640566813 Staphylococcus aureus aureus JH9 IMG   GCN5-related N-acetyltransferase
img|640780585 Staphylococcus aureus aureus JH1 IMG   GCN5-related N-acetyltransferase
img|640796733 Staphylococcus aureus aureus Newman IMG   acetyltransferase, GNAT family protein
img|640905184 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641310388 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   GNAT family acetyltransferase( EC:2.3.1.- )
img|641773053 Staphylococcus aureus aureus USA300_TCH959 IMG   GNAT family acetyltransferase
kegg|saa:SAUSA300_2348 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2400 Staphylococcus aureus subsp. aureus COL KEGG   acetyltransferase
kegg|sae:NWMN_2302 Staphylococcus aureus subsp. aureus Newman KEGG   acetyltransferase, GNAT family protein
kegg|sah:SaurJH1_2474 Staphylococcus aureus subsp. aureus JH1 KEGG   GCN5-related N-acetyltransferase
kegg|saj:SaurJH9_2426 Staphylococcus aureus subsp. aureus JH9 KEGG   GCN5-related N-acetyltransferase
kegg|sau:SA2190   KEGG   hypothetical protein
kegg|sav:SAV2402   KEGG   hypothetical protein
kegg|saw:SAHV_2386 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_2384 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   GNAT family acetyltransferase (EC:2.3.1.-)
ref|NP_372926.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV2402
ref|NP_375513.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2190
ref|YP_001247781.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   GCN5-related N-acetyltransferase
ref|YP_001317585.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   GCN5-related N-acetyltransferase
ref|YP_001333336.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   acetyltransferase, GNAT family protein
ref|YP_001442976.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2386
ref|YP_001576253.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   GNAT family acetyltransferase
ref|YP_187203.1 Staphylococcus aureus subsp. aureus COL RefSeq   acetyltransferase
ref|YP_494983.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2348
ref|ZP_03563287.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   GNAT family acetyltransferase
ref|ZP_03565813.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   GNAT family acetyltransferase
ref|ZP_04837952.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_00910
ref|ZP_04864240.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   GNAT family acetyltransferase
ref|ZP_04868347.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   GNAT family acetyltransferase
ref|ZP_05145777.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_11925
ref|ZP_05643721.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680565.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05685162.1 Staphylococcus aureus A9719 RefSeq   acetyltransferase
ref|ZP_05690388.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05691361.1 Staphylococcus aureus A8115 RefSeq   acetyltransferase
ref|ZP_05694654.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05698476.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699326.1 Staphylococcus aureus A5948 RefSeq   acetyltransferase
ref|ZP_05703200.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IVI2 Staphylococcus aureus (strain JH9) TrEMBL   GCN5-related N-acetyltransferase
tr|A6QJP2 Staphylococcus aureus (strain Newman) TrEMBL   Acetyltransferase, GNAT family protein
tr|A6U4D0 Staphylococcus aureus (strain JH1) TrEMBL   GCN5-related N-acetyltransferase
tr|A7X637 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z591 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   GNAT family acetyltransferase
tr|C5MZU8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   GNAT family acetyltransferase
tr|C5Q2H8 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   GNAT family acetyltransferase
tr|Q2FE95 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q5HDF4 Staphylococcus aureus (strain COL) TrEMBL   Acetyltransferase, GNAT family
tr|Q7A3T6 Staphylococcus aureus (strain N315) TrEMBL   Conserved hypothetcial protein
tr|Q99RM7 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search