The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2502: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
Translate Function Assignments



Context on contig NC_009641 from base 2521723 to 2535204 (13482 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2498 2525412 2521723 3690 -       3: 2 1 3   Respiratory nitrate reductase (quinol), alpha subunit (EC 1.7.5.1) gene_name|narG, locus|NWMN_2297, protein_id|YP_001333331.1, gi|151222509, geneID|5332197
2499 2526699 2525722 978 - 309 9 4: 4 5 7 6   Uroporphyrinogen-III methyltransferase (EC 2.1.1.107) gene_name|cysG, locus|NWMN_2298, protein_id|YP_001333332.1, gi|151222510, geneID|5332196
2500 2527004 2526690 315 - -10 5 3: 2 1 3   Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4) gene_name|nirD, locus|NWMN_2299, protein_id|YP_001333333.1, gi|151222511, geneID|5331849
2501 2529413 2527008 2406 - 3     3: 2 1 3   Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4) gene_name|nirB, locus|NWMN_2300, protein_id|YP_001333334.1, gi|151222512, geneID|5332205
2502 2530210 2529479 732 - 65   1: 4   Sirohydrochlorin ferrochelatase (EC 4.99.1.4) gene_name|nirR, locus|NWMN_2301, protein_id|YP_001333335.1, gi|151222513, geneID|5332204
2503 2530976 2530440 537 - 229         Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232         formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Experimental_tye SvetaG Sirohydrochlorin ferrochelatase (EC 4.99.1.4)


  Protein Sequence

>fig|426430.8.peg.2502 Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
MNGNIIVAHGMRHGRQNQALEAFISELVKDDIHHYDIAFLESEHQDLETVMTTLIQSGVD
HFKIVPLLIFSAMHYLKDIPNIVHEMKRRYPDIKVEVSEPLGTHPLMRRLIEQRICDALA
GDEQQVGVMVVAHGNINGKFTKAHEELQICAQNLQISKPTYARTLYGEISFTHDLESISK
RYQKLIVVPLFLYDGRLVNKVKQQMNDMVINTDIHFTPSINFDPILKQIINDRLESLMIP
MKI

MD5 = fd13af6992be981f10ffe0f7389a2c1d


  DNA Sequence

>fig|426430.8.peg.2502 Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
gtgaatgggaatatcattgttgcacatggcatgaggcacggacgacagaatcaagcgtta
gaagcatttatttctgaattagtaaaagatgatatacatcactatgatattgcgttttta
gaaagtgagcatcaggatttagagacggtaatgacgacgttgattcaaagtggggttgac
cattttaaaattgtaccattgctaatctttagtgcaatgcattatctcaaggatataccg
aatatcgttcatgaaatgaaacgacggtatccagacataaaggtagaagtaagcgagcca
cttggcacacatcctttaatgagacgattaattgaacaacgtatttgtgacgcattagca
ggtgacgaacaacaagttggagttatggttgttgcacacggcaatattaatggaaagttt
actaaggcacacgaagagttacaaatatgcgctcaaaatttgcaaattagcaagccgaca
tatgcgagaacgctatatggagagattagttttacacatgatttagaaagcatctcgaaa
cggtatcaaaaattgattgtcgtaccattatttttatatgacggaagacttgttaacaaa
gtgaagcagcaaatgaatgacatggttattaatacagatatacacttcacaccttcaatt
aacttcgacccaattttaaagcaaatcattaacgatagattagaaagcttaatgattcca
atgaaaatataa


  DNA with Flanking Sequence

>fig|426430.8.peg.2502 Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
gacaaatcctgagtatgaagggaaaggctatggtagccaattacttacttatgttgaaga
agcatttttgcgagatacgttaaagtcagcggcagttactttaggtacatctgcaagatt
gcatccgtggttacttaaaatttatgaaaaaagaggttatgaaatatacagcgaacatga
aaatgatgatggcgatttaggtgtgatcatgcgcaaagtattgatacccgagcgctttga
cgaaacaatattaggccaaccaccattttaagataataatatacactacaagcgaccgat
atattaatgcttgctcaaataaatgttgagtagggattcatatatcggtcgctttttttg
atttaacaaaaagggaaaatgtataaggaatatgcatgactacaggcatcagggaattcc
ctgattttacattataatgtgattcttttcacaaaaacaaaatgatttggtatacaatac
gtgtgaaagggttggtaaatgtgaatgggaatatcattgttgcacatggcatgaggcacg
gacgacagaatcaagcgttagaagcatttatttctgaattagtaaaagatgatatacatc
actatgatattgcgtttttagaaagtgagcatcaggatttagagacggtaatgacgacgt
tgattcaaagtggggttgaccattttaaaattgtaccattgctaatctttagtgcaatgc
attatctcaaggatataccgaatatcgttcatgaaatgaaacgacggtatccagacataa
aggtagaagtaagcgagccacttggcacacatcctttaatgagacgattaattgaacaac
gtatttgtgacgcattagcaggtgacgaacaacaagttggagttatggttgttgcacacg
gcaatattaatggaaagtttactaaggcacacgaagagttacaaatatgcgctcaaaatt
tgcaaattagcaagccgacatatgcgagaacgctatatggagagattagttttacacatg
atttagaaagcatctcgaaacggtatcaaaaattgattgtcgtaccattatttttatatg
acggaagacttgttaacaaagtgaagcagcaaatgaatgacatggttattaatacagata
tacacttcacaccttcaattaacttcgacccaattttaaagcaaatcattaacgatagat
tagaaagcttaatgattccaatgaaaatataaaagcactaacgaaaaattaatacctttt
tttgaaataaatattatggagtaaaggggcatattttatggcaaagcaaaaactagtaat
gattggtaacggtatggcgggcattcgaacaatcgaagaaatattagagcgcgccaacga
tttatatgatattacggtaataggtaaagaaccttatccaaactataaccgcatcatgct
ttcaaatattttacaaaataaaatgacagttgaagaaacaattatgaatccatatgagtg
gtatgaggaacatggtatcgagttaattacaaatgatcctgtaattgaagtagatagagc
aaatcaatcagttactactgcaaatggtattgaagtatcatacgataaattgatttttgc
gacaggttctaaagcattcgtcattccagttccaggttcgacattaccgagtgtaattgg
ttggagaacgattgatgatactgaacaaatgatgaacattgctaagactaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0009236       P:cobalamin biosynthetic process
GO:0016829       F:lyase activity
GO:0046872       F:metal ion binding
cmr|NT05SA2421 Staphylococcus aureus NCTC 8325     transcriptional regulator NirR
cmr|SACOL2399 Staphylococcus aureus subsp. aureus COL     transcriptional regulator NirR
cmr|SAUSA300_2347 Staphylococcus aureus subsp. aureus USA300-FPR3757     nitrite reductase transcriptional regulator NirR
dbj|BAF68573.1 Staphylococcus aureus subsp. aureus str. Newman     nitrite reductase transcriptional regulator NirR
fig|367830.3.peg.433 Staphylococcus aureus subsp. aureus USA300 FIG   Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
fig|426430.6.peg.2230 Staphylococcus aureus subsp. aureus str. Newman FIG   Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
fig|452948.4.peg.553 Staphylococcus aureus 930918-3 FIG   Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
fig|546343.3.peg.1351 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
fig|553590.4.peg.1007 Staphylococcus aureus A9754 FIG   Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
fig|644279.4.peg.2544 Staphylococcus aureus subsp. aureus 132 FIG   Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
fig|93061.3.peg.2539 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
fig|93061.5.peg.2432 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
fig|93062.4.peg.2457 Staphylococcus aureus subsp. aureus COL FIG   Sirohydrochlorin ferrochelatase (EC 4.99.1.4)
gb|AAW37224.1 Staphylococcus aureus subsp. aureus COL     transcriptional regulator NirR
gb|ABD22716.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     nitrite reductase transcriptional regulator NirR
gb|ABD31693.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30373.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     transcriptional regulator NirR
gb|EEV83901.1 Staphylococcus aureus A5948     transcriptional regulator NirR
gb|EEW45562.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1323
gb|EEW47630.1 Staphylococcus aureus D30     hypothetical protein SAD30_0658
gi|150375313 Staphylococcus aureus subsp. aureus str. Newman NCBI   nitrite reductase transcriptional regulator NirR
gi|151222513 Staphylococcus aureus subsp. aureus str. Newman NCBI   nitrite reductase transcriptional regulator NirR
gi|160369402 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   transcriptional regulator NirR
gi|161510593 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   transcriptional regulator NirR
gi|221138484 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   transcriptional regulator NirR
gi|221141321 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   transcriptional regulator NirR
gi|257861086 Staphylococcus aureus A5948 NCBI   transcriptional regulator NirR
gi|258451294 Staphylococcus aureus A5948 NCBI   transcriptional regulator NirR
gi|259160539 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1323
gi|259163069 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0658
gi|57285130 Staphylococcus aureus subsp. aureus COL NCBI   transcriptional regulator NirR
gi|57650944 Staphylococcus aureus subsp. aureus COL NCBI   transcriptional regulator NirR
gi|87128202 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   nitrite reductase transcriptional regulator NirR
gi|87162228 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   nitrite reductase transcriptional regulator NirR
gi|87203883 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196325 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02685
img|637153155 Staphylococcus aureus aureus COL IMG   transcriptional regulator NirR
img|637888990 Staphylococcus aureus aureus USA300 IMG   nitrite reductase transcriptional regulator NirR
img|637895296 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796732 Staphylococcus aureus aureus Newman IMG   nitrite reductase transcriptional regulator NirR
img|641310387 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   transcriptional regulator NirR
kegg|saa:SAUSA300_2347 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   nitrite reductase transcriptional regulator NirR
kegg|sac:SACOL2399 Staphylococcus aureus subsp. aureus COL KEGG   transcriptional regulator NirR
kegg|sae:NWMN_2301 Staphylococcus aureus subsp. aureus Newman KEGG   nitrite reductase transcriptional regulator NirR
kegg|sao:SAOUHSC_02685 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2383 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   transcriptional regulator NirR
ref|YP_001333335.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   nitrite reductase transcriptional regulator NirR
ref|YP_001576252.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   transcriptional regulator NirR
ref|YP_187202.1 Staphylococcus aureus subsp. aureus COL RefSeq   transcriptional regulator NirR
ref|YP_494982.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   nitrite reductase transcriptional regulator NirR
ref|YP_501147.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02685
ref|ZP_03563286.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   transcriptional regulator NirR
ref|ZP_03565814.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   transcriptional regulator NirR
ref|ZP_05699327.1 Staphylococcus aureus A5948 RefSeq   transcriptional regulator NirR
tr|A6QJP1 Staphylococcus aureus (strain Newman) TrEMBL   Nitrite reductase transcriptional regulator NirR
tr|A8Z590 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Transcriptional regulator NirR
tr|Q2FE96 Staphylococcus aureus (strain USA300) TrEMBL   Nitrite reductase transcriptional regulator NirR
tr|Q2G1V2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HDF5 Staphylococcus aureus (strain COL) TrEMBL   Transcriptional regulator NirR


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
9 fig|426430.8.peg.2499 Uroporphyrinogen-III methyltransferase (EC 2.1.1.107)
5 fig|426430.8.peg.2500 Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search