The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1748: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Organic hydroperoxide resistance protein
Translate Function Assignments



Context on contig NC_009641 from base 1787327 to 1799182 (11856 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1742 1788493 1787327 1167 -       6: 22 19 20 1 30 6   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73     2: 17 1   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946
1745 1790669 1791133 465 + 136     1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|NWMN_1612, protein_id|YP_001332646.1, gi|151221824, geneID|5331891
1746 1791377 1791979 603 + 243     3: 26 8 1   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|NWMN_1613, protein_id|YP_001332647.1, gi|151221825, geneID|5330947
1747 1792938 1792195 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|NWMN_1614, protein_id|YP_001332648.1, gi|151221826, geneID|5332407
1748 1793018 1793464 447 + 79     2: 24 16   Organic hydroperoxide resistance protein locus|NWMN_1615, protein_id|YP_001332649.1, gi|151221827, geneID|5330948
1749 1793578 1794738 1161 + 113     2: 3 2   Phosphoserine aminotransferase, putative (EC 2.6.1.52) locus|NWMN_1616, protein_id|YP_001332650.1, gi|151221828, geneID|5330949
1750 1794725 1796329 1605 + -14     16: 4 15 3 2 27 5 25 21 11 28 7 23 29 12 18 10   D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) gene_name|serA, locus|NWMN_1617, protein_id|YP_001332651.1, gi|151221829, geneID|5330950
1751 1797609 1796479 1131 - 149     5: 4 3 2 13 9   Phosphoserine phosphatase (EC 3.1.3.3) locus|NWMN_1618, protein_id|YP_001332652.1, gi|151221830, geneID|5332472
1752 1799182 1797716 1467 - 106     1: 14   PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIC component locus|NWMN_1619, protein_id|YP_001332653.1, gi|151221831, geneID|5330951

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-269482.1.peg.1294 natapili Organic hydroperoxide resistance protein
Oxidative_stress OlgaV Organic hydroperoxide resistance protein


  Protein Sequence

>fig|426430.8.peg.1748 Organic hydroperoxide resistance protein
MHQHDFKVQTSWQGGRNNVGNVQGDILSENISIPASLGGVGIGTNPDEMLVSAASSCYII
SLAATLERAKFTDISIEQQSIGTACLNNGKFSMSKIVHHPQIQIPSDQIAQLEKRLPKLI
TIADNNCMISNAVRNNVDIKIYPIIQAK

MD5 = c72b593243077d7e865ff822aa015a2f


  DNA Sequence

>fig|426430.8.peg.1748 Organic hydroperoxide resistance protein
ttgcatcaacatgactttaaagtccaaacttcttggcaaggtggtcgtaacaatgtcgga
aacgttcaaggcgacatactttcagagaatatttctatacctgcttctttaggtggtgtt
ggtataggaacaaatcccgatgaaatgttagtatcagccgcttcatcatgttatatcatc
tcattagcagctactcttgaacgtgcaaagttcacagatatttcaattgaacaacaatcg
attggaacagcttgtttaaataacggaaaattcagtatgtcaaaaattgtgcaccatcct
caaattcaaattccaagtgatcaaatagcacaattagaaaagcgattaccaaaattgata
acaattgcagataataattgcatgatttcaaatgctgtaagaaataatgtggacataaaa
atctatcccatcattcaggccaaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1748 Organic hydroperoxide resistance protein
cgactttcttttcttccaaaaatgccagcaatttacattctatttctggatataaattcg
gacttttcaattcaatcaatagctttttatcatactttaagcataatgaaagtacttcat
ctaacgtgggtattcgttctcccttaaaagcaacatctttataactaccaaaatcaaatg
attttaattgcgataatgtgtaatcagcaatacgccccttaccatccgatgttctatcaa
ttgtttcatcatgtatcacaacaaaatgttggtctttggtcaaatgaacatctatttcta
acatagcaacattgagccccattacctctcgataaccgaccattgtattttcaggaaaat
cactcggcaatccacggtgcgaaacaatttgtaattcatctttcagtttattcagagtca
ttgataagtcacctttctgttaaactttgataaactattctaaaattaaactatcacaat
tatattggaggttaaagcaattgcatcaacatgactttaaagtccaaacttcttggcaag
gtggtcgtaacaatgtcggaaacgttcaaggcgacatactttcagagaatatttctatac
ctgcttctttaggtggtgttggtataggaacaaatcccgatgaaatgttagtatcagccg
cttcatcatgttatatcatctcattagcagctactcttgaacgtgcaaagttcacagata
tttcaattgaacaacaatcgattggaacagcttgtttaaataacggaaaattcagtatgt
caaaaattgtgcaccatcctcaaattcaaattccaagtgatcaaatagcacaattagaaa
agcgattaccaaaattgataacaattgcagataataattgcatgatttcaaatgctgtaa
gaaataatgtggacataaaaatctatcccatcattcaggccaaataaaatcgttaagtga
taacgtttgttcgacaatatagcgttatcacttttttaggcttttaaattttcagaaaat
ttgataaaatagtgaaatcttatttataggaggcatataaatgtattatcatcaaccgtt
gttattaacacctggcccaacccctgtacctgatgccattatgagagaaattcaagcacc
tatggttggtcatcgttctaaagattttgaagacatcgcacaacaagcatttcaaggtct
aaagccaatatttgggagtcaaaatgatgtacttattttaacatctagcggtacaagcgt
cttggaggctagtatgttgaacattgtaaaccctgaagatcacttcgttgtcattgtttc
aggtgcctttggtaaccgatttaaacaaattgcacaaacttattacaaaaatgtgcatat
ttatgacgtaacatggggagaagctgtagatgtcaaagatttcatcaatttcctttcaac
tttaaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006950       P:response to stress
cmr|NT05SA1632 Staphylococcus aureus NCTC 8325     OsmC/Ohr family protein
cmr|SACOL1771 Staphylococcus aureus subsp. aureus COL     OsmC/Ohr family protein
cmr|SAUSA300_1668 Staphylococcus aureus subsp. aureus USA300-FPR3757     OsmC/Ohr family protein
dbj|BAF67887.1 Staphylococcus aureus subsp. aureus str. Newman     osmotic stress-related protein
fig|367830.3.peg.1009 Staphylococcus aureus subsp. aureus USA300 FIG   Organic hydroperoxide resistance protein
fig|426430.6.peg.1566 Staphylococcus aureus subsp. aureus str. Newman FIG   Organic hydroperoxide resistance protein
fig|450394.6.peg.973 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Organic hydroperoxide resistance protein
fig|451515.3.peg.1819 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Organic hydroperoxide resistance protein
fig|451516.9.peg.1808 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Organic hydroperoxide resistance protein
fig|452948.4.peg.831 Staphylococcus aureus 930918-3 FIG   Organic hydroperoxide resistance protein
fig|455227.3.peg.1052 Staphylococcus aureus D30 FIG   Organic hydroperoxide resistance protein
fig|546342.3.peg.940 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Organic hydroperoxide resistance protein
fig|546343.3.peg.2418 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Organic hydroperoxide resistance protein
fig|553567.3.peg.374 Staphylococcus aureus A5948 FIG   Organic hydroperoxide resistance protein
fig|553590.4.peg.1943 Staphylococcus aureus A9754 FIG   Organic hydroperoxide resistance protein
fig|553594.3.peg.1818 Staphylococcus aureus A9765 FIG   Organic hydroperoxide resistance protein
fig|644279.4.peg.1867 Staphylococcus aureus subsp. aureus 132 FIG   Organic hydroperoxide resistance protein
fig|93061.3.peg.1666 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Organic hydroperoxide resistance protein
fig|93061.5.peg.1670 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Organic hydroperoxide resistance protein
fig|93062.19.peg.1728 Staphylococcus aureus subsp. aureus COL FIG   Organic hydroperoxide resistance protein
fig|93062.4.peg.438 Staphylococcus aureus subsp. aureus COL FIG   Organic hydroperoxide resistance protein
gb|AAW38300.1 Staphylococcus aureus subsp. aureus COL     OsmC/Ohr family protein
gb|ABD21980.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     OsmC/Ohr family protein
gb|ABD30899.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29717.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1710
gb|EEV84228.1 Staphylococcus aureus A5948     OsmC/Ohr family protein
gb|EEW45306.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0447
gb|EEW47416.1 Staphylococcus aureus D30     hypothetical protein SAD30_2240
gi|150374627 Staphylococcus aureus subsp. aureus str. Newman NCBI   osmotic stress-related protein
gi|151221827 Staphylococcus aureus subsp. aureus str. Newman NCBI   osmotic stress-related protein
gi|160368746 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1710
gi|161509937 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1710
gi|221137952 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_04758
gi|221142356 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_12087
gi|257861420 Staphylococcus aureus A5948 NCBI   OsmC/Ohr family protein
gi|258450884 Staphylococcus aureus A5948 NCBI   OsmC/Ohr family protein
gi|259160279 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0447
gi|259162852 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2240
gi|57286206 Staphylococcus aureus subsp. aureus COL NCBI   OsmC/Ohr family protein
gi|57652020 Staphylococcus aureus subsp. aureus COL NCBI   OsmC/Ohr family protein
gi|87127466 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   OsmC/Ohr family protein
gi|87161492 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   OsmC/Ohr family protein
gi|87203089 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195531 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01831
img|637152505 Staphylococcus aureus aureus COL IMG   OsmC/Ohr family protein
img|637888317 Staphylococcus aureus aureus USA300 IMG   OsmC/Ohr family protein
img|637894431 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795996 Staphylococcus aureus aureus Newman IMG   osmotic stress-related protein
img|641309670 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641771631 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1668 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   OsmC/Ohr family protein
kegg|sac:SACOL1771 Staphylococcus aureus subsp. aureus COL KEGG   OsmC/Ohr family protein
kegg|sae:NWMN_1615 Staphylococcus aureus subsp. aureus Newman KEGG   osmotic stress-related protein
kegg|sao:SAOUHSC_01831 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_1710 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001332649.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   osmotic stress-related protein
ref|YP_001575596.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1710
ref|YP_186605.1 Staphylococcus aureus subsp. aureus COL RefSeq   OsmC/Ohr family protein
ref|YP_494362.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   OsmC/Ohr family protein
ref|YP_500337.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01831
ref|ZP_03562754.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_04758
ref|ZP_03566849.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_12087
ref|ZP_05698937.1 Staphylococcus aureus A5948 RefSeq   OsmC/Ohr family protein
tr|A6QHQ5 Staphylococcus aureus (strain Newman) TrEMBL   Osmotic stress-related protein
tr|A8Z2N9 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|Q2FG16 Staphylococcus aureus (strain USA300) TrEMBL   OsmC/Ohr family protein
tr|Q2FXK3 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HF52 Staphylococcus aureus (strain COL) TrEMBL   OsmC/Ohr family protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search