The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|426430.8.peg.1746: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
Translate Function Assignments


Context on contig NC_009641 from base 1786104 to 1797609 (11506 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
1741 1787327 1786104 1224 -   5 2: 31 26   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1     6: 21 18 19 1 30 6   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73 4 2: 16 1   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946
1745 1790669 1791133 465 + 136     1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|NWMN_1612, protein_id|YP_001332646.1, gi|151221824, geneID|5331891
1746 1791377 1791979 603 + 243   3: 25 8 1   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|NWMN_1613, protein_id|YP_001332647.1, gi|151221825, geneID|5330947
1747 1792938 1792195 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|NWMN_1614, protein_id|YP_001332648.1, gi|151221826, geneID|5332407
1748 1793018 1793464 447 + 79     2: 23 15   Organic hydroperoxide resistance protein locus|NWMN_1615, protein_id|YP_001332649.1, gi|151221827, geneID|5330948
1749 1793578 1794738 1161 + 113     2: 3 2   Phosphoserine aminotransferase, putative (EC 2.6.1.52) locus|NWMN_1616, protein_id|YP_001332650.1, gi|151221828, geneID|5330949
1750 1794725 1796329 1605 + -14     16: 4 14 3 2 27 5 24 20 11 28 7 22 29 12 17 10   D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) gene_name|serA, locus|NWMN_1617, protein_id|YP_001332651.1, gi|151221829, geneID|5330950
1751 1797609 1796479 1131 - 149     5: 4 3 2 13 9   Phosphoserine phosphatase (EC 3.1.3.3) locus|NWMN_1618, protein_id|YP_001332652.1, gi|151221830, geneID|5332472

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-393130.3.peg.794 OlgaV SSU ribosomal protein S4p (S9e)
Single-copy_ribosomal_proteins gjo SSU ribosomal protein S4p (S9e)
Ribosome_SSU_bacterial gjo SSU ribosomal protein S4p (S9e)


  Protein Sequence

>fig|426430.8.peg.1746 SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
MARFRGSNWKKSRRLGISLSGTGKELEKRPYAPGQHGPNQRKKLSEYGLQLREKQKLRYL
YGMTERQFRNTFDIAGKKFGVHGENFMILLASRLDAVVYSLGLARTRRQARQLVNHGHIL
VDGKRVDIPSYSVKPGQTISVREKSQKLNIIVESVEINNFVPEYLNFDADSLTGTFVRLP
ERSELPAEINEQLIVEYYSR

MD5 = 912d03cd165d6ceb35d19cba2541214e


  DNA Sequence

>fig|426430.8.peg.1746 SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
atggctcgattcagaggttcaaactggaaaaaatctcgtcgtttaggtatctctttaagc
ggtactggtaaagaattagaaaaacgtccttacgcaccaggacaacatggtccaaaccaa
cgtaaaaaattatcagaatatggtttacaattacgtgaaaaacaaaaattacgttactta
tatggaatgactgaaagacaattccgtaacacatttgacatcgctggtaaaaaattcggt
gtacacggtgaaaacttcatgatcttattagcaagtcgtttagacgctgttgtttattca
ttaggtttagctcgtactcgtcgtcaagcacgtcaattagttaaccacggtcatatctta
gtagatggtaaacgtgttgatattccatcttattctgttaaacctggtcaaacaatttca
gttcgtgaaaaatctcaaaaattaaacatcatcgttgaatcagttgaaatcaacaatttc
gtacctgagtacttaaactttgatgctgacagcttaactggtactttcgtacgtttacca
gaacgtagcgaattacctgctgaaattaacgaacaattaatcgttgagtactactcaaga
taa


  DNA with Flanking Sequence

>fig|426430.8.peg.1746 SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
acattccaattggaaaaggtgtatgtggtacagccgtttcagaacgtcgtacacaaattg
tagctgatgttcatcaattcgaaggacatatcgcttgtgatgctaatagtaagtctgaga
ttgtcgttccaattttcaaagatgataaaattatcggcgtcttagatatcgatgccccta
taacggatcgatttgatgacaatgacaaagaacatcttgaagcaattgttaaaattattg
aaaagcaactcgcataaaaggacatcagcattttcaataaagtgttgacagttagcagga
aaatgttacaataatctttgtgtgaattaacgaaagtagcagttgtatattattgagcgc
tatgttgttcccaatgcggacgtgtcacgtaactgtcgctataaggtgaagacacataaa
acaatatatcttagtaagcatgcaacactcttttttgtttattcataacaacaaaaaaga
attaaaggaggagtcttattatggctcgattcagaggttcaaactggaaaaaatctcgtc
gtttaggtatctctttaagcggtactggtaaagaattagaaaaacgtccttacgcaccag
gacaacatggtccaaaccaacgtaaaaaattatcagaatatggtttacaattacgtgaaa
aacaaaaattacgttacttatatggaatgactgaaagacaattccgtaacacatttgaca
tcgctggtaaaaaattcggtgtacacggtgaaaacttcatgatcttattagcaagtcgtt
tagacgctgttgtttattcattaggtttagctcgtactcgtcgtcaagcacgtcaattag
ttaaccacggtcatatcttagtagatggtaaacgtgttgatattccatcttattctgtta
aacctggtcaaacaatttcagttcgtgaaaaatctcaaaaattaaacatcatcgttgaat
cagttgaaatcaacaatttcgtacctgagtacttaaactttgatgctgacagcttaactg
gtactttcgtacgtttaccagaacgtagcgaattacctgctgaaattaacgaacaattaa
tcgttgagtactactcaagataatacgttcaatacaaacacccacaattgtgggtgtttt
ttttattaatttaaaaatgatagattcaaaattatatggagctaccctattttacaatca
acttagaatttacaagtcttatttgtttaattatctttagtatttcatcattagttttta
aaattatcaattgcgatatacgaatcctcatccctctatcaaattaccattcatcgtctc
acttaataaataatttcggattatctgtaattaatccatctacacccatttgtcttaatt
tttctccagttttcaatttattaactgtgtatggcataacctgtaattgatgatgatgtg
ctttatcaacaaattttctggtcactaatgcataattaggattaacataactagcaattt
gagcaattcttgaaaagtttggctttttataccaataattacgtttactacaaagcacac
ctaattcatatatactgcccaatgtgtttaacttttcgatgca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003735       F:structural constituent of ribosome
GO:0006412       P:translation
GO:0015935       C:small ribosomal subunit
GO:0019843       F:rRNA binding
cmr|NT01SA1684 Staphylococcus aureus N315     ribosomal protein S4
cmr|NT02SA1696 Staphylococcus aureus Mu50     ribosomal protein S4
cmr|NT03SA1805 Staphylococcus aureus MW2     ribosomal protein S4
cmr|NT05SA1630 Staphylococcus aureus NCTC 8325     ribosomal protein S4
cmr|NT09SA1631 Staphylococcus aureus subsp. aureus MSSA476     ribosomal protein S4
cmr|NT11SA1599 Staphylococcus aureus RF122     ribosomal protein S4
cmr|SACOL1769 Staphylococcus aureus subsp. aureus COL     ribosomal protein S4
cmr|SAUSA300_1666 Staphylococcus aureus subsp. aureus USA300-FPR3757     30S ribosomal protein S4
dbj|BAB42808.1 Staphylococcus aureus subsp. aureus N315     30S ribosomal protein S4
dbj|BAB57881.1 Staphylococcus aureus subsp. aureus Mu50     30S ribosomal protein S4
dbj|BAB95527.1 Staphylococcus aureus subsp. aureus MW2     30S ribosomal protein S4
dbj|BAF67885.1 Staphylococcus aureus subsp. aureus str. Newman     30S ribosomal protein S4
dbj|BAF78588.1 Staphylococcus aureus subsp. aureus Mu3     30S ribosomal protein S4
emb|CAG43448.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   30S ribosomal protein S4
emb|CAI81267.1 Staphylococcus aureus RF122 EMBL   30S ribosomal protein S4
fig|158878.1.peg.1719 Staphylococcus aureus subsp. aureus Mu50 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|158878.14.peg.1774 Staphylococcus aureus subsp. aureus Mu50 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|158879.1.peg.1591 Staphylococcus aureus subsp. aureus N315 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|158879.11.peg.1662 Staphylococcus aureus subsp. aureus N315 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|196620.1.peg.1662 Staphylococcus aureus subsp. aureus MW2 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|196620.5.peg.1731 Staphylococcus aureus subsp. aureus MW2 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|273036.3.peg.1561 Staphylococcus aureus RF122 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|273036.6.peg.1674 Staphylococcus aureus RF122 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|282459.1.peg.1632 Staphylococcus aureus subsp. aureus MSSA476 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|282459.5.peg.1710 Staphylococcus aureus subsp. aureus MSSA476 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|359786.13.peg.1877 Staphylococcus aureus subsp. aureus JH9 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|359786.3.peg.1729 Staphylococcus aureus subsp. aureus JH9 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|359787.11.peg.1853 Staphylococcus aureus subsp. aureus JH1 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|359787.3.peg.202 Staphylococcus aureus subsp. aureus JH1 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|367830.3.peg.1007 Staphylococcus aureus subsp. aureus USA300 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|418127.4.peg.1586 Staphylococcus aureus subsp. aureus Mu3 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|418127.6.peg.1751 Staphylococcus aureus subsp. aureus Mu3 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|426430.6.peg.1564 Staphylococcus aureus subsp. aureus str. Newman FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|450394.6.peg.971 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|451515.3.peg.1817 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|451516.9.peg.1806 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|452948.4.peg.833 Staphylococcus aureus 930918-3 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|455227.3.peg.1054 Staphylococcus aureus D30 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|505321.3.peg.564 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|548475.3.peg.704 Staphylococcus aureus subsp. aureus TCH70 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553565.3.peg.891 Staphylococcus aureus A5937 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553567.3.peg.376 Staphylococcus aureus A5948 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553568.3.peg.681 Staphylococcus aureus A6224 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553571.3.peg.994 Staphylococcus aureus A6300 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553573.3.peg.1549 Staphylococcus aureus A8115 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553574.3.peg.560 Staphylococcus aureus A8117 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553577.3.peg.1117 Staphylococcus aureus A8796 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553580.3.peg.1172 Staphylococcus aureus A8819 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553581.3.peg.1639 Staphylococcus aureus A9299 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553583.3.peg.1658 Staphylococcus aureus A9635 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553590.4.peg.1941 Staphylococcus aureus A9754 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553592.3.peg.2125 Staphylococcus aureus A9763 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553594.3.peg.1816 Staphylococcus aureus A9765 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553596.3.peg.981 Staphylococcus aureus A9781 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|553601.3.peg.1392 Staphylococcus aureus A10102 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|585152.3.peg.1711 Staphylococcus aureus subsp. aureus D139 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|585155.3.peg.1952 Staphylococcus aureus subsp. aureus H19 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|585891.3.peg.1771 Staphylococcus aureus subsp. aureus Mu50-omega FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|644279.4.peg.1865 Staphylococcus aureus subsp. aureus 132 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|680649.3.peg.1799 Staphylococcus aureus subsp. aureus MR1 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|681288.4.peg.1732 Staphylococcus aureus subsp. aureus ED98 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|703339.3.peg.1710 Staphylococcus aureus 04-02981 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|762962.3.peg.269 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|93061.3.peg.1663 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|93061.5.peg.1668 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|93062.19.peg.1726 Staphylococcus aureus subsp. aureus COL FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
fig|93062.4.peg.436 Staphylococcus aureus subsp. aureus COL FIG   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent
gb|AAW38298.1 Staphylococcus aureus subsp. aureus COL     ribosomal protein S4
gb|ABD20402.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     30S ribosomal protein S4
gb|ABD30897.1 Staphylococcus aureus subsp. aureus NCTC 8325     ribosomal protein S4
gb|ABQ49565.1 Staphylococcus aureus subsp. aureus JH9     SSU ribosomal protein S4P
gb|ABR52654.1 Staphylococcus aureus subsp. aureus JH1     ribosomal protein S4
gb|ABX29714.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     ribosomal protein S4
gb|EES54476.1 Staphylococcus aureus subsp. aureus TCH70     30S ribosomal protein S4
gb|EES92620.1 Staphylococcus aureus subsp. aureus USA300_TCH959     30S ribosomal protein S4
gb|EEV26415.1 Staphylococcus aureus A9781     30S ribosomal protein S4
gb|EEV63873.1 Staphylococcus aureus A9763     30S ribosomal protein S4
gb|EEV69787.1 Staphylococcus aureus A9635     SSU ribosomal protein S4
gb|EEV72321.1 Staphylococcus aureus A9299     ribosomal protein S4
gb|EEV75093.1 Staphylococcus aureus A8115     ribosomal protein S4
gb|EEV78136.1 Staphylococcus aureus A6300     30S ribosomal protein S4
gb|EEV81218.1 Staphylococcus aureus A6224     ribosomal protein S4
gb|EEV84230.1 Staphylococcus aureus A5948     30S ribosomal protein S4
gb|EEV86364.1 Staphylococcus aureus A5937     SSU ribosomal protein S4P
gb|EEW45305.1 Staphylococcus aureus 930918-3     30S ribosomal protein S4
gb|EEW47414.1 Staphylococcus aureus D30     30S ribosomal protein S4
gi|122539301 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|123485448 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|13701514 Staphylococcus aureus subsp. aureus N315 NCBI   30S ribosomal protein S4
gi|14247491 Staphylococcus aureus subsp. aureus Mu50 NCBI   30S ribosomal protein S4
gi|147741267 Staphylococcus aureus subsp. aureus JH9 NCBI   SSU ribosomal protein S4P
gi|148268198 Staphylococcus aureus subsp. aureus JH9 NCBI   30S ribosomal protein S4
gi|149946718 Staphylococcus aureus subsp. aureus JH1 NCBI   ribosomal protein S4
gi|150374625 Staphylococcus aureus subsp. aureus str. Newman NCBI   30S ribosomal protein S4
gi|150394266 Staphylococcus aureus subsp. aureus JH1 NCBI   30S ribosomal protein S4
gi|151221825 Staphylococcus aureus subsp. aureus str. Newman NCBI   30S ribosomal protein S4
gi|156722171 Staphylococcus aureus subsp. aureus Mu3 NCBI   30S ribosomal protein S4
gi|156980036 Staphylococcus aureus subsp. aureus Mu3 NCBI   30S ribosomal protein S4
gi|15924709 Staphylococcus aureus subsp. aureus Mu50 NCBI   30S ribosomal protein S4
gi|15927296 Staphylococcus aureus subsp. aureus N315 NCBI   30S ribosomal protein S4
gi|160368743 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   ribosomal protein S4
gi|161509934 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   30S ribosomal protein S4
gi|171769945 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|172048947 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|189045401 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|189045402 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|189045403 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|21204831 Staphylococcus aureus subsp. aureus MW2 NCBI   30S ribosomal protein S4
gi|21283391 Staphylococcus aureus subsp. aureus MW2 NCBI   30S ribosomal protein S4
gi|251801819 Staphylococcus aureus subsp. aureus TCH70 NCBI   30S ribosomal protein S4
gi|251814710 Staphylococcus aureus subsp. aureus TCH70 NCBI   30S ribosomal protein S4
gi|253315106 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   30S ribosomal protein S4
gi|253723891 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   30S ribosomal protein S4
gi|253732369 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   30S ribosomal protein S4
gi|255006504 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   30S ribosomal protein S4
gi|257788075 Staphylococcus aureus A9781 NCBI   30S ribosomal protein S4
gi|257794103 Staphylococcus aureus A9781 NCBI   30S ribosomal protein S4
gi|257839400 Staphylococcus aureus A9763 NCBI   30S ribosomal protein S4
gi|257845755 Staphylococcus aureus A9635 NCBI   SSU ribosomal protein S4
gi|257848330 Staphylococcus aureus A9299 NCBI   ribosomal protein S4
gi|257851150 Staphylococcus aureus A8115 NCBI   ribosomal protein S4
gi|257855197 Staphylococcus aureus A6300 NCBI   30S ribosomal protein S4
gi|257858333 Staphylococcus aureus A6224 NCBI   ribosomal protein S4
gi|257861422 Staphylococcus aureus A5948 NCBI   30S ribosomal protein S4
gi|257863607 Staphylococcus aureus A5937 NCBI   SSU ribosomal protein S4P
gi|258415807 Staphylococcus aureus A9763 NCBI   30S ribosomal protein S4
gi|258424134 Staphylococcus aureus A9635 NCBI   SSU ribosomal protein S4
gi|258438286 Staphylococcus aureus A9299 NCBI   ribosomal protein S4
gi|258443744 Staphylococcus aureus A8115 NCBI   ribosomal protein S4
gi|258445955 Staphylococcus aureus A6300 NCBI   30S ribosomal protein S4
gi|258448365 Staphylococcus aureus A6224 NCBI   ribosomal protein S4
gi|258450886 Staphylococcus aureus A5948 NCBI   30S ribosomal protein S4
gi|258454155 Staphylococcus aureus A5937 NCBI   SSU ribosomal protein S4P
gi|259160278 Staphylococcus aureus 930918-3 NCBI   30S ribosomal protein S4
gi|259162850 Staphylococcus aureus D30 NCBI   30S ribosomal protein S4
gi|49244987 Staphylococcus aureus subsp. aureus MSSA476 NCBI   30S ribosomal protein S4
gi|49486544 Staphylococcus aureus subsp. aureus MSSA476 NCBI   30S ribosomal protein S4
gi|54039510 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|54039511 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|54041963 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|56749380 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|57286204 Staphylococcus aureus subsp. aureus COL NCBI   ribosomal protein S4
gi|57652018 Staphylococcus aureus subsp. aureus COL NCBI   30S ribosomal protein S4
gi|62287184 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
gi|82656838 Staphylococcus aureus RF122 NCBI   30S ribosomal protein S4
gi|82751307 Staphylococcus aureus RF122 NCBI   30S ribosomal protein S4
gi|87125888 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   30S ribosomal protein S4
gi|87159914 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   30S ribosomal protein S4
gi|87203087 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   ribosomal protein S4
gi|88195529 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   30S ribosomal protein S4
gi|90101727 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S4
img|637093211 Staphylococcus aureus aureus N315 IMG   30S ribosomal protein S4
img|637100227 Staphylococcus aureus aureus Mu50 IMG   30S ribosomal protein S4
img|637152503 Staphylococcus aureus aureus COL IMG   30S ribosomal protein S4
img|637157869 Staphylococcus aureus aureus MSSA476 IMG   30S ribosomal protein S4
img|637299426 Staphylococcus aureus aureus MW2 IMG   30S ribosomal protein S4
img|637816519 Staphylococcus aureus RF122 IMG   30S ribosomal protein S4
img|637888315 Staphylococcus aureus aureus USA300 IMG   30S ribosomal protein S4
img|637894428 Staphylococcus aureus aureus NCTC 8325 IMG   ribosomal protein S4
img|639108508 Staphylococcus aureus aureus JH1 IMG   Ribosomal protein S4, bacterial and organelle form
img|640566118 Staphylococcus aureus aureus JH9 IMG   ribosomal protein S4
img|640779888 Staphylococcus aureus aureus JH1 IMG   ribosomal protein S4
img|640795994 Staphylococcus aureus aureus Newman IMG   30S ribosomal protein S4
img|640904449 Staphylococcus aureus aureus Mu3 IMG   30S ribosomal protein S4
img|641309667 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   ribosomal protein S4
img|641771634 Staphylococcus aureus aureus USA300_TCH959 IMG   ribosomal protein S4
kegg|saa:SAUSA300_1666 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   30S ribosomal protein S4
kegg|sab:SAB1578 Staphylococcus aureus RF122 KEGG   30S ribosomal protein S4
kegg|sac:SACOL1769 Staphylococcus aureus subsp. aureus COL KEGG   30S ribosomal protein S4
kegg|sae:NWMN_1613 Staphylococcus aureus subsp. aureus Newman KEGG   30S ribosomal protein S4
kegg|sah:SaurJH1_1810 Staphylococcus aureus subsp. aureus JH1 KEGG   30S ribosomal protein S4
kegg|saj:SaurJH9_1775 Staphylococcus aureus subsp. aureus JH9 KEGG   30S ribosomal protein S4
kegg|sam:MW1662 Staphylococcus aureus subsp. aureus MW2 KEGG   30S ribosomal protein S4
kegg|sao:SAOUHSC_01829 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   30S ribosomal protein S4
kegg|sas:SAS1646   KEGG   30S ribosomal protein S4
kegg|sau:SAS052   KEGG   30S ribosomal protein S4
kegg|sav:SAV1719   KEGG   30S ribosomal protein S4
kegg|saw:SAHV_1705 Staphylococcus aureus subsp. aureus Mu3 KEGG   30S ribosomal protein S4
kegg|sax:USA300HOU_1707 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   30S ribosomal protein S4
ref|NP_372243.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   30S ribosomal protein S4
ref|NP_374829.1 Staphylococcus aureus subsp. aureus N315 RefSeq   30S ribosomal protein S4
ref|NP_646479.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   30S ribosomal protein S4
ref|YP_001247141.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   30S ribosomal protein S4
ref|YP_001316941.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   30S ribosomal protein S4
ref|YP_001332647.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   30S ribosomal protein S4
ref|YP_001442295.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   30S ribosomal protein S4
ref|YP_001575593.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   30S ribosomal protein S4
ref|YP_043765.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   30S ribosomal protein S4
ref|YP_186603.1 Staphylococcus aureus subsp. aureus COL RefSeq   30S ribosomal protein S4
ref|YP_417048.1 Staphylococcus aureus RF122 RefSeq   30S ribosomal protein S4
ref|YP_494360.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   30S ribosomal protein S4
ref|YP_500334.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   30S ribosomal protein S4
ref|ZP_04829183.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   30S ribosomal protein S4
ref|ZP_04838319.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   30S ribosomal protein S4
ref|ZP_04866534.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   30S ribosomal protein S4
ref|ZP_05145105.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   30S ribosomal protein S4
ref|ZP_05643082.1 Staphylococcus aureus A9781 RefSeq   30S ribosomal protein S4
ref|ZP_05682078.1 Staphylococcus aureus A9763 RefSeq   30S ribosomal protein S4
ref|ZP_05687016.1 Staphylococcus aureus A9635 RefSeq   SSU ribosomal protein S4
ref|ZP_05689570.1 Staphylococcus aureus A9299 RefSeq   ribosomal protein S4
ref|ZP_05692083.1 Staphylococcus aureus A8115 RefSeq   ribosomal protein S4
ref|ZP_05694131.1 Staphylococcus aureus A6300 RefSeq   30S ribosomal protein S4
ref|ZP_05696482.1 Staphylococcus aureus A6224 RefSeq   ribosomal protein S4
ref|ZP_05698939.1 Staphylococcus aureus A5948 RefSeq   30S ribosomal protein S4
ref|ZP_05702126.1 Staphylococcus aureus A5937 RefSeq   SSU ribosomal protein S4P
sp|A5ITP2 Staphylococcus aureus (strain JH9) SwissProt   30S ribosomal protein S4
sp|A6QHQ3 Staphylococcus aureus (strain Newman) SwissProt   30S ribosomal protein S4
sp|A6U2I6 Staphylococcus aureus (strain JH1) SwissProt   30S ribosomal protein S4
sp|A7X3F0 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   30S ribosomal protein S4
sp|A8Z2N6 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   30S ribosomal protein S4
sp|P66562 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   30S ribosomal protein S4
sp|P66563 Staphylococcus aureus (strain N315) SwissProt   30S ribosomal protein S4
sp|P66564 Staphylococcus aureus (strain MW2) SwissProt   30S ribosomal protein S4
sp|Q2FG18 Staphylococcus aureus (strain USA300) SwissProt   30S ribosomal protein S4
sp|Q2FXK6 Staphylococcus aureus (strain NCTC 8325) SwissProt   30S ribosomal protein S4
sp|Q2YTH0 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   30S ribosomal protein S4
sp|Q5HF54 Staphylococcus aureus (strain COL) SwissProt   30S ribosomal protein S4
sp|Q6G8K8 Staphylococcus aureus (strain MSSA476) SwissProt   30S ribosomal protein S4
sp|RS4_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
sp|RS4_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S4
tr|C5N6E2 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   30S ribosomal protein S4
tr|C5QK67 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   30S ribosomal protein S4


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function
5 fig|426430.8.peg.1741 tRNA S(4)U 4-thiouridine synthase (former ThiI)
4 fig|426430.8.peg.1744 Septation ring formation regulator EzrA


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search