The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1745: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Free methionine-(R)-sulfoxide reductase, contains GAF domain
Translate Function Assignments



Context on contig NC_009641 from base 1785290 to 1796329 (11040 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1740 1786060 1785290 771 -           Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43 7 2: 29 15   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1 7 6: 12 10 23 1 28 19   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73 11 2: 22 1   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946
1745 1790669 1791133 465 + 136   1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|NWMN_1612, protein_id|YP_001332646.1, gi|151221824, geneID|5331891
1746 1791377 1791979 603 + 243     3: 26 4 1   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|NWMN_1613, protein_id|YP_001332647.1, gi|151221825, geneID|5330947
1747 1792938 1792195 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|NWMN_1614, protein_id|YP_001332648.1, gi|151221826, geneID|5332407
1748 1793018 1793464 447 + 79     2: 13 8   Organic hydroperoxide resistance protein locus|NWMN_1615, protein_id|YP_001332649.1, gi|151221827, geneID|5330948
1749 1793578 1794738 1161 + 113     2: 3 2   Phosphoserine aminotransferase, putative (EC 2.6.1.52) locus|NWMN_1616, protein_id|YP_001332650.1, gi|151221828, geneID|5330949
1750 1794725 1796329 1605 + -14     16: 24 21 3 2 16 18 14 11 6 17 20 25 27 7 9 5   D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) gene_name|serA, locus|NWMN_1617, protein_id|YP_001332651.1, gi|151221829, geneID|5330950

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-393130.3.peg.794 OlgaV CDS_ID OB2202


  Protein Sequence

>fig|426430.8.peg.1745 Free methionine-(R)-sulfoxide reductase, contains GAF domain
MTTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILG
PFQGHPACVHIPIGKGVCGTAVSERRTQIVADVHQFEGHIACDANSKSEIVVPIFKDDKI
IGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA

MD5 = 1c4ad236b164ff95ce81df32c1c8f607


  DNA Sequence

>fig|426430.8.peg.1745 Free methionine-(R)-sulfoxide reductase, contains GAF domain
atgacaacaattaacccaacaaactacacattattaaagaaacaagcagcaagccttatt
gaagatgaacatcacatgattgctattttaagtaacatgtctgccttattaaatgataat
ctagatcaaattaattgggttggcttttacttattggaacaaaatgaacttatacttgga
cctttccaaggacaccccgcttgtgtccacattccaattggaaaaggtgtatgtggtaca
gccgtttcagaacgtcgtacacaaattgtagctgatgttcatcaattcgaaggacatatc
gcttgtgatgctaatagtaagtctgagattgtcgttccaattttcaaagatgataaaatt
atcggcgtcttagatatcgatgcccctataacggatcgatttgatgacaatgacaaagaa
catcttgaagcaattgttaaaattattgaaaagcaactcgcataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1745 Free methionine-(R)-sulfoxide reductase, contains GAF domain
gatagctttgttcgtaactatccatcaactcatttgcatcatcaatttcactttgagatg
cgttgaaactaaatttatctaataaagcctcagcattatggattttttcttccacaggag
ctagatacttatttgtactttctacgttgtcctttttcattgcatcgtatttcgtttttg
tttcaccttttaaattcaacttagataattgtgcaaggttttgatcaaaaggtaacgtct
caatttcatttttacgttcgattgctttttcaataatttgtcgtttatttgaacgtaaat
agaataatacacctacagcaatcaatataatcacaattattgccaaaatgatatataaca
ccatatgcttctcctcctaatttatcattactattataacgtaattttgcttaaggataa
attataaaatgaatttattgccataatattttcgaaattctatactattataaaatctat
gaaaataagaggttttaaatatgacaacaattaacccaacaaactacacattattaaaga
aacaagcagcaagccttattgaagatgaacatcacatgattgctattttaagtaacatgt
ctgccttattaaatgataatctagatcaaattaattgggttggcttttacttattggaac
aaaatgaacttatacttggacctttccaaggacaccccgcttgtgtccacattccaattg
gaaaaggtgtatgtggtacagccgtttcagaacgtcgtacacaaattgtagctgatgttc
atcaattcgaaggacatatcgcttgtgatgctaatagtaagtctgagattgtcgttccaa
ttttcaaagatgataaaattatcggcgtcttagatatcgatgcccctataacggatcgat
ttgatgacaatgacaaagaacatcttgaagcaattgttaaaattattgaaaagcaactcg
cataaaaggacatcagcattttcaataaagtgttgacagttagcaggaaaatgttacaat
aatctttgtgtgaattaacgaaagtagcagttgtatattattgagcgctatgttgttccc
aatgcggacgtgtcacgtaactgtcgctataaggtgaagacacataaaacaatatatctt
agtaagcatgcaacactcttttttgtttattcataacaacaaaaaagaattaaaggagga
gtcttattatggctcgattcagaggttcaaactggaaaaaatctcgtcgtttaggtatct
ctttaagcggtactggtaaagaattagaaaaacgtccttacgcaccaggacaacatggtc
caaaccaacgtaaaaaattatcagaatatggtttacaattacgtgaaaaacaaaaattac
gttacttatatggaatgactgaaagacaattccgtaacacatttgacatcgctggtaaaa
aattcggtgtacacggtgaaaactt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1629 Staphylococcus aureus NCTC 8325     GAF domain protein
cmr|SACOL1768 Staphylococcus aureus subsp. aureus COL     GAF domain protein
cmr|SAUSA300_1665 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF67884.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.1006 Staphylococcus aureus subsp. aureus USA300 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|426430.6.peg.1563 Staphylococcus aureus subsp. aureus str. Newman FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|450394.6.peg.970 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|451515.3.peg.1816 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|451516.9.peg.1805 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|452948.4.peg.834 Staphylococcus aureus 930918-3 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|455227.3.peg.1055 Staphylococcus aureus D30 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|546342.3.peg.937 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|546343.3.peg.2415 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|548474.3.peg.2176 Staphylococcus aureus subsp. aureus TCH130 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|553567.3.peg.377 Staphylococcus aureus A5948 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|553590.4.peg.1940 Staphylococcus aureus A9754 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|553594.3.peg.1815 Staphylococcus aureus A9765 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|644279.4.peg.1864 Staphylococcus aureus subsp. aureus 132 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|93061.3.peg.1662 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|93061.5.peg.1667 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
fig|93062.4.peg.435 Staphylococcus aureus subsp. aureus COL FIG   Free methionine-(R)-sulfoxide reductase, contains GAF domain
gb|AAW38297.1 Staphylococcus aureus subsp. aureus COL     GAF domain protein
gb|ABD22094.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30896.1 Staphylococcus aureus subsp. aureus NCTC 8325     GAF domain protein
gb|ABX29713.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible GAF domain protein
gb|EES92619.1 Staphylococcus aureus subsp. aureus USA300_TCH959     GAF domain protein
gb|EES96280.1 Staphylococcus aureus subsp. aureus TCH130     GAF domain protein
gb|EEV84231.1 Staphylococcus aureus A5948     GAF domain-containing protein
gb|EEW45304.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0445
gb|EEW47413.1 Staphylococcus aureus D30     hypothetical protein SAD30_2237
gi|150374624 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221824 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1612
gi|160368742 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible GAF domain protein
gi|161509933 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   GAF domain-containing protein
gi|221137949 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   GAF domain-containing protein
gi|221142353 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   GAF domain-containing protein
gi|253723890 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GAF domain protein
gi|253727551 Staphylococcus aureus subsp. aureus TCH130 NCBI   GAF domain protein
gi|253732368 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GAF domain protein
gi|253734497 Staphylococcus aureus subsp. aureus TCH130 NCBI   GAF domain protein
gi|257861423 Staphylococcus aureus A5948 NCBI   GAF domain-containing protein
gi|258450887 Staphylococcus aureus A5948 NCBI   GAF domain-containing protein
gi|259160277 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0445
gi|259162849 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2237
gi|57286203 Staphylococcus aureus subsp. aureus COL NCBI   GAF domain protein
gi|57652017 Staphylococcus aureus subsp. aureus COL NCBI   GAF domain-containing protein
gi|87127580 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161606 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1665
gi|87203086 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   GAF domain protein
gi|88195528 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   GAF domain-containing protein
img|637152502 Staphylococcus aureus aureus COL IMG   GAF domain protein
img|637888314 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637894427 Staphylococcus aureus aureus NCTC 8325 IMG   GAF domain protein
img|640795993 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641309666 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible GAF domain protein
img|641771635 Staphylococcus aureus aureus USA300_TCH959 IMG   possible GAF domain protein
kegg|saa:SAUSA300_1665 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1768 Staphylococcus aureus subsp. aureus COL KEGG   GAF domain-containing protein
kegg|sae:NWMN_1612 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_01828 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   GAF domain-containing protein
kegg|sax:USA300HOU_1706 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   GAF domain-containing protein
ref|YP_001332646.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1612
ref|YP_001575592.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   GAF domain-containing protein
ref|YP_186602.1 Staphylococcus aureus subsp. aureus COL RefSeq   GAF domain-containing protein
ref|YP_494359.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1665
ref|YP_500333.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   GAF domain-containing protein
ref|ZP_03562751.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   GAF domain-containing protein
ref|ZP_03566846.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   GAF domain-containing protein
ref|ZP_04866533.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   GAF domain protein
ref|ZP_04868662.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   GAF domain protein
ref|ZP_05698940.1 Staphylococcus aureus A5948 RefSeq   GAF domain-containing protein
tr|A6QHQ2 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z2N5 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible GAF domain protein
tr|C5N6E1 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   GAF domain protein
tr|C5Q3E3 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   GAF domain protein
tr|Q2FG19 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FXK7 Staphylococcus aureus (strain NCTC 8325) TrEMBL   GAF domain protein
tr|Q5HF55 Staphylococcus aureus (strain COL) TrEMBL   GAF domain protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|426430.8.peg.1741 tRNA S(4)U 4-thiouridine synthase (former ThiI)
7 fig|426430.8.peg.1742 Cysteine desulfurase (EC 2.8.1.7)
11 fig|426430.8.peg.1744 Septation ring formation regulator EzrA


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search