The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1744: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Septation ring formation regulator EzrA
Translate Function Assignments



Context on contig NC_009641 from base 1783628 to 1796329 (12702 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1738 1784575 1783628 948 -       2: 23 4   Adenine-specific methyltransferase (EC 2.1.1.72) locus|NWMN_1606, protein_id|YP_001332640.1, gi|151221818, geneID|5331711
1739 1785192 1784698 495 - 122 4 2: 19 4   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|NWMN_1607, protein_id|YP_001332641.1, gi|151221819, geneID|5330943
1740 1786060 1785290 771 - 97         Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43 11 2: 32 16   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1 11 6: 13 11 26 1 31 21   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73   2: 25 1   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946
1745 1790669 1791133 465 + 136 6 1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|NWMN_1612, protein_id|YP_001332646.1, gi|151221824, geneID|5331891
1746 1791377 1791979 603 + 243 4 3: 29 5 1   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|NWMN_1613, protein_id|YP_001332647.1, gi|151221825, geneID|5330947
1747 1792938 1792195 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|NWMN_1614, protein_id|YP_001332648.1, gi|151221826, geneID|5332407
1748 1793018 1793464 447 + 79     2: 14 9   Organic hydroperoxide resistance protein locus|NWMN_1615, protein_id|YP_001332649.1, gi|151221827, geneID|5330948
1749 1793578 1794738 1161 + 113     2: 3 2   Phosphoserine aminotransferase, putative (EC 2.6.1.52) locus|NWMN_1616, protein_id|YP_001332650.1, gi|151221828, geneID|5330949
1750 1794725 1796329 1605 + -14     16: 27 24 3 2 17 20 15 12 7 18 22 28 30 8 10 6   D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) gene_name|serA, locus|NWMN_1617, protein_id|YP_001332651.1, gi|151221829, geneID|5330950

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-393130.3.peg.794 OlgaV Septation ring formation regulator EzrA
Control_of_cell_elongation_-_division_cycle_in_Bacilli SvetaG Septation ring formation regulator EzrA


  Protein Sequence

>fig|426430.8.peg.1744 Septation ring formation regulator EzrA
MVLYIILAIIVIILIAVGVLFYLRSNKRQIIEKAIERKNEIETLPFDQNLAQLSKLNLKG
ETKTKYDAMKKDNVESTNKYLAPVEEKIHNAEALLDKFSFNASQSEIDDANELMDSYEQS
YQQQLEDVNEIIALYKDNDELYDKCKVDYREMKRDVLANRHQFGEAASLLETEIEKFEPR
LEQYEVLKADGNYVQAHNHIAALNEQMKQLRSYMEEIPELIRETQKELPGQFQDLKYGCR
DLKVEGYDLDHVKVDSTLQSLKTELSFVEPLISRLELEEANDKLANINDKLDDMYDLIEH
EVKAKNDVEETKDIITDNLFKAKDMNYTLQTEIEYVRENYYINESDAQSVRQFENEIQSL
ISVYDDILKEMSKSAVRYSEVQDNLQYLEDHVTVINDKQEKLQNHLIQLREDEAEAEDNL
LRVQSKKEEVYRRLLASNLTSVPERFIIMKNEIDHEVRDVNEQFSERPIHVKQLKDKVSK
IVIQMNTFEDEANDVLVNAVYAEKLIQYGNRYRKDYSNVDKSLNEAERLFKNNRYKRAIE
IAEQALESVEPGVTKHIEEEVIKQ

MD5 = 3f3ccc39a7dbd2e44dcfbcdcc87b3a68


  DNA Sequence

>fig|426430.8.peg.1744 Septation ring formation regulator EzrA
atggtgttatatatcattttggcaataattgtgattatattgattgctgtaggtgtatta
ttctatttacgttcaaataaacgacaaattattgaaaaagcaatcgaacgtaaaaatgaa
attgagacgttaccttttgatcaaaaccttgcacaattatctaagttgaatttaaaaggt
gaaacaaaaacgaaatacgatgcaatgaaaaaggacaacgtagaaagtacaaataagtat
ctagctcctgtggaagaaaaaatccataatgctgaggctttattagataaatttagtttc
aacgcatctcaaagtgaaattgatgatgcaaatgagttgatggatagttacgaacaaagc
tatcagcaacaattagaagatgtaaatgaaattattgcgttatacaaagataatgatgaa
ttatatgacaaatgtaaggttgattatcgtgaaatgaaacgtgatgttttagcaaatcgt
catcaatttggtgaggcagcaagtctacttgaaactgaaattgaaaaatttgagccaagg
ttagagcaatatgaagtactaaaagctgatggtaattatgtacaagcgcacaaccatata
gctgccttgaatgaacaaatgaaacagctaagatcttatatggaagaaataccagaatta
attagagaaactcaaaaagaattacctggtcaattccaagatttaaaatatggttgccgt
gatcttaaagttgaagggtatgatctggatcacgtgaaagtagacagtacattacaaagc
ttaaaaacagagcttagtttcgttgaaccattaattagccgcttagaattagaagaagct
aatgataaactagctaatatcaatgataagttagatgacatgtatgatttaattgaacat
gaagttaaagctaaaaatgatgtcgaagaaacaaaagatatcattacggataacttattc
aaagctaaagacatgaattatacattgcaaacagaaattgaatatgtacgtgaaaactac
tatataaatgaatctgatgctcagagtgttcgtcaatttgaaaatgaaattcaaagttta
atttctgtatatgatgatattttaaaagaaatgtctaaatctgctgtgcgatatagcgag
gttcaggataatttacaatatttagaagatcatgtcacagttattaatgacaaacaagaa
aagctacaaaatcatctgattcaattgcgtgaagatgaagcagaagcagaagacaatctg
ctacgagtacaatcgaagaaagaagaagtgtatcgtcgattacttgcttctaacttaaca
agcgttcctgaaaggtttatcatcatgaaaaatgaaattgatcatgaagttcgtgatgtt
aacgaacaatttagtgaacgtccaatacacgttaaacagttaaaagataaagtgtctaaa
attgtgattcaaatgaatacatttgaagatgaagcaaatgatgttcttgttaatgctgtt
tatgcagagaaattaattcaatatggaaatagatatcgtaaggactatagcaatgttgat
aagagcttaaatgaagctgaacgattatttaaaaataatcgctataagcgtgcgattgaa
attgcagagcaagctcttgaaagtgttgagccaggtgttactaaacatattgaagaagaa
gttattaagcaatag


  DNA with Flanking Sequence

>fig|426430.8.peg.1744 Septation ring formation regulator EzrA
cgataattttatcatctttgaaaattggaacgacaatctcagacttactattagcatcac
aagcgatatgtccttcgaattgatgaacatcagctacaatttgtgtacgacgttctgaaa
cggctgtaccacatacaccttttccaattggaatgtggacacaagcggggtgtccttgga
aaggtccaagtataagttcattttgttccaataagtaaaagccaacccaattaatttgat
ctagattatcatttaataaggcagacatgttacttaaaatagcaatcatgtgatgttcat
cttcaataaggcttgctgcttgtttctttaataatgtgtagtttgttgggttaattgttg
tcatatttaaaacctcttattttcatagattttataatagtatagaatttcgaaaatatt
atggcaataaattcattttataatttatccttaagcaaaattacgttataatagtaatga
taaattaggaggagaagcatatggtgttatatatcattttggcaataattgtgattatat
tgattgctgtaggtgtattattctatttacgttcaaataaacgacaaattattgaaaaag
caatcgaacgtaaaaatgaaattgagacgttaccttttgatcaaaaccttgcacaattat
ctaagttgaatttaaaaggtgaaacaaaaacgaaatacgatgcaatgaaaaaggacaacg
tagaaagtacaaataagtatctagctcctgtggaagaaaaaatccataatgctgaggctt
tattagataaatttagtttcaacgcatctcaaagtgaaattgatgatgcaaatgagttga
tggatagttacgaacaaagctatcagcaacaattagaagatgtaaatgaaattattgcgt
tatacaaagataatgatgaattatatgacaaatgtaaggttgattatcgtgaaatgaaac
gtgatgttttagcaaatcgtcatcaatttggtgaggcagcaagtctacttgaaactgaaa
ttgaaaaatttgagccaaggttagagcaatatgaagtactaaaagctgatggtaattatg
tacaagcgcacaaccatatagctgccttgaatgaacaaatgaaacagctaagatcttata
tggaagaaataccagaattaattagagaaactcaaaaagaattacctggtcaattccaag
atttaaaatatggttgccgtgatcttaaagttgaagggtatgatctggatcacgtgaaag
tagacagtacattacaaagcttaaaaacagagcttagtttcgttgaaccattaattagcc
gcttagaattagaagaagctaatgataaactagctaatatcaatgataagttagatgaca
tgtatgatttaattgaacatgaagttaaagctaaaaatgatgtcgaagaaacaaaagata
tcattacggataacttattcaaagctaaagacatgaattatacattgcaaacagaaattg
aatatgtacgtgaaaactactatataaatgaatctgatgctcagagtgttcgtcaatttg
aaaatgaaattcaaagtttaatttctgtatatgatgatattttaaaagaaatgtctaaat
ctgctgtgcgatatagcgaggttcaggataatttacaatatttagaagatcatgtcacag
ttattaatgacaaacaagaaaagctacaaaatcatctgattcaattgcgtgaagatgaag
cagaagcagaagacaatctgctacgagtacaatcgaagaaagaagaagtgtatcgtcgat
tacttgcttctaacttaacaagcgttcctgaaaggtttatcatcatgaaaaatgaaattg
atcatgaagttcgtgatgttaacgaacaatttagtgaacgtccaatacacgttaaacagt
taaaagataaagtgtctaaaattgtgattcaaatgaatacatttgaagatgaagcaaatg
atgttcttgttaatgctgtttatgcagagaaattaattcaatatggaaatagatatcgta
aggactatagcaatgttgataagagcttaaatgaagctgaacgattatttaaaaataatc
gctataagcgtgcgattgaaattgcagagcaagctcttgaaagtgttgagccaggtgtta
ctaaacatattgaagaagaagttattaagcaatagaaactagtatgtagttatacttaaa
taatatgagcactctgtcaaattggactgatgagtttaataattgaagttagccaacgat
acgttgtctagcttcttttttatatggataaatgaaagggacaataaatataaatagcaa
ttgtttaaagataaacgtaatcaaatgtgttgttttaattaatataagtagtgaaaaaag
cataatcacacagctgtttaaatagagtgaaatagtctaattcttatttaataagtagaa
ataagattattttgcgctataacctttattttttgtcggataatagtataatgcttgagt
aaaacaattttaacgattgatgattaatgaaagagaagtgtttattttgatatatctaga
taatgcggcaacgacgaaagcatttgaagaagtgttagatacttatttaaaagtaaatca
atcaatgtattataatccgaatagtccgcataaagctggtttgcaggcaaatcaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0000917       P:barrier septum formation
GO:0000921       P:septin ring assembly
GO:0005488       F:binding
GO:0005886       C:plasma membrane
GO:0005940       C:septin ring
GO:0007049       P:cell cycle
GO:0016021       C:integral to membrane
cmr|NT03SA1803 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT09SA1629 Staphylococcus aureus subsp. aureus MSSA476     septation ring formation regulator EzrA
cmr|NT11SA1597 Staphylococcus aureus RF122     septation ring formation regulator EzrA
cmr|SACOL1767 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_1664 Staphylococcus aureus subsp. aureus USA300-FPR3757     septation ring formation regulator EzrA
dbj|BAB95525.1 Staphylococcus aureus subsp. aureus MW2     MW1660
dbj|BAF67883.1 Staphylococcus aureus subsp. aureus str. Newman     septation ring formation regulator EzrA
emb|CAG43446.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative septation ring formation regulator
emb|CAI81265.1 Staphylococcus aureus RF122 EMBL   conserved hypothetical protein
fig|196620.1.peg.1660 Staphylococcus aureus subsp. aureus MW2 FIG   Septation ring formation regulator EzrA
fig|196620.5.peg.1729 Staphylococcus aureus subsp. aureus MW2 FIG   Septation ring formation regulator EzrA
fig|273036.3.peg.1559 Staphylococcus aureus RF122 FIG   Septation ring formation regulator EzrA
fig|273036.6.peg.1672 Staphylococcus aureus RF122 FIG   Septation ring formation regulator EzrA
fig|282459.1.peg.1630 Staphylococcus aureus subsp. aureus MSSA476 FIG   Septation ring formation regulator EzrA
fig|282459.5.peg.1708 Staphylococcus aureus subsp. aureus MSSA476 FIG   Septation ring formation regulator EzrA
fig|359786.13.peg.1875 Staphylococcus aureus subsp. aureus JH9 FIG   Septation ring formation regulator EzrA
fig|359786.3.peg.1727 Staphylococcus aureus subsp. aureus JH9 FIG   Septation ring formation regulator EzrA
fig|359787.11.peg.1851 Staphylococcus aureus subsp. aureus JH1 FIG   Septation ring formation regulator EzrA
fig|359787.3.peg.315 Staphylococcus aureus subsp. aureus JH1 FIG   Septation ring formation regulator EzrA
fig|367830.3.peg.1005 Staphylococcus aureus subsp. aureus USA300 FIG   Septation ring formation regulator EzrA
fig|426430.6.peg.1562 Staphylococcus aureus subsp. aureus str. Newman FIG   Septation ring formation regulator EzrA
fig|450394.6.peg.969 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Septation ring formation regulator EzrA
fig|451515.3.peg.1815 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Septation ring formation regulator EzrA
fig|451516.9.peg.1804 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Septation ring formation regulator EzrA
fig|452948.4.peg.835 Staphylococcus aureus 930918-3 FIG   Septation ring formation regulator EzrA
fig|455227.3.peg.1056 Staphylococcus aureus D30 FIG   Septation ring formation regulator EzrA
fig|505321.3.peg.566 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Septation ring formation regulator EzrA
fig|546342.3.peg.936 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Septation ring formation regulator EzrA
fig|546343.3.peg.2414 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Septation ring formation regulator EzrA
fig|548475.3.peg.702 Staphylococcus aureus subsp. aureus TCH70 FIG   Septation ring formation regulator EzrA
fig|553565.3.peg.889 Staphylococcus aureus A5937 FIG   Septation ring formation regulator EzrA
fig|553567.3.peg.378 Staphylococcus aureus A5948 FIG   Septation ring formation regulator EzrA
fig|553568.3.peg.683 Staphylococcus aureus A6224 FIG   Septation ring formation regulator EzrA
fig|553571.3.peg.992 Staphylococcus aureus A6300 FIG   Septation ring formation regulator EzrA
fig|553573.3.peg.1547 Staphylococcus aureus A8115 FIG   Septation ring formation regulator EzrA
fig|553574.3.peg.558 Staphylococcus aureus A8117 FIG   Septation ring formation regulator EzrA
fig|553577.3.peg.1119 Staphylococcus aureus A8796 FIG   Septation ring formation regulator EzrA
fig|553580.3.peg.1170 Staphylococcus aureus A8819 FIG   Septation ring formation regulator EzrA
fig|553581.3.peg.1637 Staphylococcus aureus A9299 FIG   Septation ring formation regulator EzrA
fig|553588.3.peg.2294 Staphylococcus aureus A9719 FIG   Septation ring formation regulator EzrA
fig|553590.4.peg.1939 Staphylococcus aureus A9754 FIG   Septation ring formation regulator EzrA
fig|553592.3.peg.2123 Staphylococcus aureus A9763 FIG   Septation ring formation regulator EzrA
fig|553594.3.peg.1814 Staphylococcus aureus A9765 FIG   Septation ring formation regulator EzrA
fig|553596.3.peg.979 Staphylococcus aureus A9781 FIG   Septation ring formation regulator EzrA
fig|553601.3.peg.1390 Staphylococcus aureus A10102 FIG   Septation ring formation regulator EzrA
fig|585152.3.peg.1709 Staphylococcus aureus subsp. aureus D139 FIG   Septation ring formation regulator EzrA
fig|585155.3.peg.1950 Staphylococcus aureus subsp. aureus H19 FIG   Septation ring formation regulator EzrA
fig|644279.4.peg.1863 Staphylococcus aureus subsp. aureus 132 FIG   Septation ring formation regulator EzrA
fig|680649.3.peg.1801 Staphylococcus aureus subsp. aureus MR1 FIG   Septation ring formation regulator EzrA
fig|681288.4.peg.1730 Staphylococcus aureus subsp. aureus ED98 FIG   Septation ring formation regulator EzrA
fig|703339.3.peg.1708 Staphylococcus aureus 04-02981 FIG   Septation ring formation regulator EzrA
fig|762962.3.peg.271 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Septation ring formation regulator EzrA
fig|93062.19.peg.1724 Staphylococcus aureus subsp. aureus COL FIG   Septation ring formation regulator EzrA
fig|93062.4.peg.434 Staphylococcus aureus subsp. aureus COL FIG   Septation ring formation regulator EzrA
gb|AAW38296.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21517.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     septation ring formation regulator EzrA
gb|ABQ49563.1 Staphylococcus aureus subsp. aureus JH9     Septation ring formation regulator, EzrA
gb|ABR52652.1 Staphylococcus aureus subsp. aureus JH1     Septation ring formation regulator EzrA
gb|ABX29712.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible septation ring formation regulator
gb|EES54474.1 Staphylococcus aureus subsp. aureus TCH70     septation ring formation regulator
gb|EES92618.1 Staphylococcus aureus subsp. aureus USA300_TCH959     septation ring formation regulator
gb|EEV26413.1 Staphylococcus aureus A9781     septation ring formation regulator EzrA
gb|EEV63871.1 Staphylococcus aureus A9763     septation ring formation regulator ezrA
gb|EEV66431.1 Staphylococcus aureus A9719     septation ring formation regulator EzrA
gb|EEV72319.1 Staphylococcus aureus A9299     septation ring formation regulator ezrA
gb|EEV75091.1 Staphylococcus aureus A8115     septation ring formation regulator ezrA
gb|EEV78134.1 Staphylococcus aureus A6300     septation ring formation regulator ezrA
gb|EEV81220.1 Staphylococcus aureus A6224     septation ring formation regulator ezrA
gb|EEV84232.1 Staphylococcus aureus A5948     septation ring formation regulator ezrA
gb|EEV86362.1 Staphylococcus aureus A5937     septation ring formation regulator ezrA
gb|EEW45324.1 Staphylococcus aureus 930918-3     septation ring formation regulator EzrA
gb|EEW47412.1 Staphylococcus aureus D30     septation ring formation regulator EzrA
gi|123740970 organism not parsed/found in ncbi nr NCBI   RecName: Full=Septation ring formation regulator ezrA
gi|123763283 organism not parsed/found in ncbi nr NCBI   RecName: Full=Septation ring formation regulator ezrA
gi|147741265 Staphylococcus aureus subsp. aureus JH9 NCBI   Septation ring formation regulator, EzrA
gi|148268196 Staphylococcus aureus subsp. aureus JH9 NCBI   septation ring formation regulator EzrA
gi|149946716 Staphylococcus aureus subsp. aureus JH1 NCBI   Septation ring formation regulator EzrA
gi|150374623 Staphylococcus aureus subsp. aureus str. Newman NCBI   septation ring formation regulator EzrA
gi|150394264 Staphylococcus aureus subsp. aureus JH1 NCBI   septation ring formation regulator EzrA
gi|151221823 Staphylococcus aureus subsp. aureus str. Newman NCBI   septation ring formation regulator EzrA
gi|160368741 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible septation ring formation regulator
gi|161509932 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   septation ring formation regulator EzrA
gi|172048946 organism not parsed/found in ncbi nr NCBI   RecName: Full=Septation ring formation regulator ezrA
gi|189037870 organism not parsed/found in ncbi nr NCBI   RecName: Full=Septation ring formation regulator ezrA
gi|189037871 organism not parsed/found in ncbi nr NCBI   RecName: Full=Septation ring formation regulator ezrA
gi|189037872 organism not parsed/found in ncbi nr NCBI   RecName: Full=Septation ring formation regulator ezrA
gi|21204829 Staphylococcus aureus subsp. aureus MW2 NCBI   MW1660
gi|21283389 Staphylococcus aureus subsp. aureus MW2 NCBI   septation ring formation regulator EzrA
gi|221137948 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   septation ring formation regulator EzrA
gi|221142352 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   septation ring formation regulator EzrA
gi|251801817 Staphylococcus aureus subsp. aureus TCH70 NCBI   septation ring formation regulator
gi|251814708 Staphylococcus aureus subsp. aureus TCH70 NCBI   septation ring formation regulator
gi|253315108 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   septation ring formation regulator EzrA
gi|253723889 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   septation ring formation regulator
gi|253732367 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   septation ring formation regulator
gi|257788073 Staphylococcus aureus A9781 NCBI   septation ring formation regulator EzrA
gi|257794101 Staphylococcus aureus A9781 NCBI   septation ring formation regulator EzrA
gi|257839398 Staphylococcus aureus A9763 NCBI   septation ring formation regulator ezrA
gi|257842002 Staphylococcus aureus A9719 NCBI   septation ring formation regulator EzrA
gi|257848328 Staphylococcus aureus A9299 NCBI   septation ring formation regulator ezrA
gi|257851148 Staphylococcus aureus A8115 NCBI   septation ring formation regulator ezrA
gi|257855195 Staphylococcus aureus A6300 NCBI   septation ring formation regulator ezrA
gi|257858335 Staphylococcus aureus A6224 NCBI   septation ring formation regulator ezrA
gi|257861424 Staphylococcus aureus A5948 NCBI   septation ring formation regulator ezrA
gi|257863605 Staphylococcus aureus A5937 NCBI   septation ring formation regulator ezrA
gi|258415805 Staphylococcus aureus A9763 NCBI   septation ring formation regulator ezrA
gi|258421958 Staphylococcus aureus A9719 NCBI   septation ring formation regulator EzrA
gi|258438284 Staphylococcus aureus A9299 NCBI   septation ring formation regulator ezrA
gi|258443742 Staphylococcus aureus A8115 NCBI   septation ring formation regulator ezrA
gi|258445953 Staphylococcus aureus A6300 NCBI   septation ring formation regulator ezrA
gi|258448367 Staphylococcus aureus A6224 NCBI   septation ring formation regulator ezrA
gi|258450888 Staphylococcus aureus A5948 NCBI   septation ring formation regulator ezrA
gi|258454153 Staphylococcus aureus A5937 NCBI   septation ring formation regulator ezrA
gi|259160297 Staphylococcus aureus 930918-3 NCBI   septation ring formation regulator EzrA
gi|259162848 Staphylococcus aureus D30 NCBI   septation ring formation regulator EzrA
gi|38503056 organism not parsed/found in ncbi nr NCBI   RecName: Full=Septation ring formation regulator ezrA
gi|49244985 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative septation ring formation regulator
gi|49486542 Staphylococcus aureus subsp. aureus MSSA476 NCBI   septation ring formation regulator EzrA
gi|57286202 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57652016 Staphylococcus aureus subsp. aureus COL NCBI   septation ring formation regulator EzrA
gi|81649160 organism not parsed/found in ncbi nr NCBI   RecName: Full=Septation ring formation regulator ezrA
gi|81694298 organism not parsed/found in ncbi nr NCBI   RecName: Full=Septation ring formation regulator ezrA
gi|82656836 Staphylococcus aureus RF122 NCBI   conserved hypothetical protein
gi|82751305 Staphylococcus aureus RF122 NCBI   septation ring formation regulator EzrA
gi|87127003 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   septation ring formation regulator EzrA
gi|87161029 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   septation ring formation regulator EzrA
img|637152501 Staphylococcus aureus aureus COL IMG   septation ring formation regulator EzrA
img|637157867 Staphylococcus aureus aureus MSSA476 IMG   septation ring formation regulator EzrA
img|637299424 Staphylococcus aureus aureus MW2 IMG   septation ring formation regulator EzrA
img|637816517 Staphylococcus aureus RF122 IMG   hypothetical protein
img|637888313 Staphylococcus aureus aureus USA300 IMG   septation ring formation regulator EzrA
img|639109080 Staphylococcus aureus aureus JH1 IMG   Septation ring formation regulator, EzrA
img|640566116 Staphylococcus aureus aureus JH9 IMG   Septation ring formation regulator, EzrA
img|640779886 Staphylococcus aureus aureus JH1 IMG   Septation ring formation regulator EzrA
img|640795992 Staphylococcus aureus aureus Newman IMG   septation ring formation regulator EzrA
img|641309665 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible septation ring formation regulator
img|641771636 Staphylococcus aureus aureus USA300_TCH959 IMG   septation ring formation regulator EzrA
kegg|saa:SAUSA300_1664 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   septation ring formation regulator EzrA
kegg|sab:SAB1576c Staphylococcus aureus RF122 KEGG   septation ring formation regulator EzrA
kegg|sac:SACOL1767 Staphylococcus aureus subsp. aureus COL KEGG   septation ring formation regulator EzrA
kegg|sae:NWMN_1611 Staphylococcus aureus subsp. aureus Newman KEGG   septation ring formation regulator EzrA
kegg|sah:SaurJH1_1808 Staphylococcus aureus subsp. aureus JH1 KEGG   septation ring formation regulator EzrA
kegg|saj:SaurJH9_1773 Staphylococcus aureus subsp. aureus JH9 KEGG   septation ring formation regulator EzrA
kegg|sam:MW1660 Staphylococcus aureus subsp. aureus MW2 KEGG   septation ring formation regulator EzrA
kegg|sas:SAS1644   KEGG   septation ring formation regulator EzrA
kegg|sax:USA300HOU_1705 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   septation ring formation regulator EzrA
ref|NP_646477.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   septation ring formation regulator EzrA
ref|YP_001247139.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   septation ring formation regulator EzrA
ref|YP_001316939.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   septation ring formation regulator EzrA
ref|YP_001332645.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   septation ring formation regulator EzrA
ref|YP_001575591.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   septation ring formation regulator EzrA
ref|YP_043763.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   septation ring formation regulator EzrA
ref|YP_186601.1 Staphylococcus aureus subsp. aureus COL RefSeq   septation ring formation regulator EzrA
ref|YP_417046.1 Staphylococcus aureus RF122 RefSeq   septation ring formation regulator EzrA
ref|YP_494358.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   septation ring formation regulator EzrA
ref|ZP_03562750.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   septation ring formation regulator EzrA
ref|ZP_03566845.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   septation ring formation regulator EzrA
ref|ZP_04829181.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   septation ring formation regulator
ref|ZP_04838321.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   septation ring formation regulator EzrA
ref|ZP_04866532.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   septation ring formation regulator
ref|ZP_05643080.1 Staphylococcus aureus A9781 RefSeq   septation ring formation regulator EzrA
ref|ZP_05682076.1 Staphylococcus aureus A9763 RefSeq   septation ring formation regulator ezrA
ref|ZP_05684878.1 Staphylococcus aureus A9719 RefSeq   septation ring formation regulator EzrA
ref|ZP_05689568.1 Staphylococcus aureus A9299 RefSeq   septation ring formation regulator ezrA
ref|ZP_05692081.1 Staphylococcus aureus A8115 RefSeq   septation ring formation regulator ezrA
ref|ZP_05694129.1 Staphylococcus aureus A6300 RefSeq   septation ring formation regulator ezrA
ref|ZP_05696484.1 Staphylococcus aureus A6224 RefSeq   septation ring formation regulator ezrA
ref|ZP_05698941.1 Staphylococcus aureus A5948 RefSeq   septation ring formation regulator ezrA
ref|ZP_05702124.1 Staphylococcus aureus A5937 RefSeq   septation ring formation regulator ezrA
sp|A5ITP0 Staphylococcus aureus (strain JH9) SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|A6QHQ1 Staphylococcus aureus (strain Newman) SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|A6U2I4 Staphylococcus aureus (strain JH1) SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|A8Z2N4 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|EZRA_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|EZRA_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|EZRA_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|EZRA_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|EZRA_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|EZRA_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|EZRA_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|EZRA_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|EZRA_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|Q2FG20 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|Q2YTH2 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|Q5HF56 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|Q6G8L0 Staphylococcus aureus (strain MSSA476) SwissProt   RecName: Full=Septation ring formation regulator ezrA
sp|Q8NW47 Staphylococcus aureus (strain MW2) SwissProt   RecName: Full=Septation ring formation regulator ezrA
tr|C5N6E0 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Septation ring formation regulator
tr|C5QK65 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Septation ring formation regulator


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|426430.8.peg.1739 Thiol peroxidase, Tpx-type (EC 1.11.1.15)
11 fig|426430.8.peg.1741 tRNA S(4)U 4-thiouridine synthase (former ThiI)
11 fig|426430.8.peg.1742 Cysteine desulfurase (EC 2.8.1.7)
6 fig|426430.8.peg.1745 Free methionine-(R)-sulfoxide reductase, contains GAF domain
4 fig|426430.8.peg.1746 SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search