The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1743: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01108306: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 1783628 to 1794738 (11111 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1738 1784575 1783628 948 -       2: 12 2   Adenine-specific methyltransferase (EC 2.1.1.72) locus|NWMN_1606, protein_id|YP_001332640.1, gi|151221818, geneID|5331711
1739 1785192 1784698 495 - 122     2: 10 2   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|NWMN_1607, protein_id|YP_001332641.1, gi|151221819, geneID|5330943
1740 1786060 1785290 771 - 97         Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43     2: 18 9   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1     6: 7 6 14 1 17 11   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73     2: 13 1   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946
1745 1790669 1791133 465 + 136     1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|NWMN_1612, protein_id|YP_001332646.1, gi|151221824, geneID|5331891
1746 1791377 1791979 603 + 243     3: 16 3 1   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|NWMN_1613, protein_id|YP_001332647.1, gi|151221825, geneID|5330947
1747 1792938 1792195 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|NWMN_1614, protein_id|YP_001332648.1, gi|151221826, geneID|5332407
1748 1793018 1793464 447 + 79     2: 8 5   Organic hydroperoxide resistance protein locus|NWMN_1615, protein_id|YP_001332649.1, gi|151221827, geneID|5330948
1749 1793578 1794738 1161 + 113     2: 15 4   Phosphoserine aminotransferase, putative (EC 2.6.1.52) locus|NWMN_1616, protein_id|YP_001332650.1, gi|151221828, geneID|5330949

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1743 FIG01108306: hypothetical protein
MLFSLLILIKTTHLITFIFKQLLFIFIVPFIYPYKKEARQRIVG

MD5 = 2e87e6fccabba3a9d0f5d6051be83994


  DNA Sequence

>fig|426430.8.peg.1743 FIG01108306: hypothetical protein
atgcttttttcactacttatattaattaaaacaacacatttgattacgtttatctttaaa
caattgctatttatatttattgtccctttcatttatccatataaaaaagaagctagacaa
cgtatcgttggctaa


  DNA with Flanking Sequence

>fig|426430.8.peg.1743 FIG01108306: hypothetical protein
cgtgtgcttccaaatatcttacaacctctaatacggacggatgctctaacacggatgtaa
ttatttccttcgctgtatcaaatttacgataggcaataccttttaaagcaagattattgg
attcagttgcaccactagtgaatacaacatcataatttgtttttgaattaatcattgcat
taatttgggtttttgcttgttgtagtaattgatttgcctgcaaaccagctttatgcggac
tattcggattataatacattgattgatttacttttaaataagtatctaacacttcttcaa
atgctttcgtcgttgccgcattatctagatatatcaaaataaacacttctctttcattaa
tcatcaatcgttaaaattgttttactcaagcattatactattatccgacaaaaaataaag
gttatagcgcaaaataatcttatttctacttattaaataagaattagactatttcactct
atttaaacagctgtgtgattatgcttttttcactacttatattaattaaaacaacacatt
tgattacgtttatctttaaacaattgctatttatatttattgtccctttcatttatccat
ataaaaaagaagctagacaacgtatcgttggctaacttcaattattaaactcatcagtcc
aatttgacagagtgctcatattatttaagtataactacatactagtttctattgcttaat
aacttcttcttcaatatgtttagtaacacctggctcaacactttcaagagcttgctctgc
aatttcaatcgcacgcttatagcgattatttttaaataatcgttcagcttcatttaagct
cttatcaacattgctatagtccttacgatatctatttccatattgaattaatttctctgc
ataaacagcattaacaagaacatcatttgcttcatcttcaaatgtattcatttgaatcac
aattttagacactttatcttttaactgtttaacgtgtattggacgttcactaaattgttc
gttaacatcacgaacttcatgatcaatttcatttttcatgatgataaacctttcaggaac
gcttgttaagttagaagcaagtaatcgacgatacacttcttctttcttcgattgt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1627 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|NT09SA1628 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein
fig|196620.5.peg.1728 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108306: hypothetical protein
fig|282459.5.peg.1707 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108306: hypothetical protein
fig|451515.3.peg.1814 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01108306: hypothetical protein
fig|451516.9.peg.1803 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108306: hypothetical protein
fig|452948.4.peg.836 Staphylococcus aureus 930918-3 FIG   FIG01108306: hypothetical protein
fig|455227.3.peg.1057 Staphylococcus aureus D30 FIG   FIG01108306: hypothetical protein
fig|546342.3.peg.935 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01108306: hypothetical protein
fig|546343.3.peg.2413 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01108306: hypothetical protein
fig|548474.3.peg.2178 Staphylococcus aureus subsp. aureus TCH130 FIG   FIG01108306: hypothetical protein
fig|548475.3.peg.701 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01108306: hypothetical protein
fig|553567.3.peg.379 Staphylococcus aureus A5948 FIG   FIG01108306: hypothetical protein
fig|553590.4.peg.1938 Staphylococcus aureus A9754 FIG   FIG01108306: hypothetical protein
fig|553594.3.peg.1813 Staphylococcus aureus A9765 FIG   FIG01108306: hypothetical protein
fig|644279.4.peg.1862 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108306: hypothetical protein
fig|762962.3.peg.272 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01108306: hypothetical protein
fig|93061.5.peg.1665 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108306: hypothetical protein
gb|EES54473.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EES96282.1 Staphylococcus aureus subsp. aureus TCH130     conserved hypothetical protein
gi|251801816 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251814707 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253727553 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|253734499 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
ref|ZP_04829180.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04868664.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   conserved hypothetical protein
tr|C5Q3E5 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Putative uncharacterized protein
tr|C5QK64 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search