The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1741: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: tRNA S(4)U 4-thiouridine synthase (former ThiI)
Translate Function Assignments



Context on contig NC_009641 from base 1780333 to 1792938 (12606 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1735 1781451 1780333 1119 -       3: 14 3 6   Alanine dehydrogenase (EC 1.4.1.1) gene_name|ald, locus|NWMN_1603, protein_id|YP_001332637.1, gi|151221815, geneID|5330941
1736 1781592 1782092 501 + 140     2: 10 3   Universal stress protein family locus|NWMN_1604, protein_id|YP_001332638.1, gi|151221816, geneID|5331728
1737 1783540 1782338 1203 - 245     6: 13 8 15 19 20 2   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|NWMN_1605, protein_id|YP_001332639.1, gi|151221817, geneID|5330942
1738 1784575 1783628 948 - 87     2: 7 2   Adenine-specific methyltransferase (EC 2.1.1.72) locus|NWMN_1606, protein_id|YP_001332640.1, gi|151221818, geneID|5331711
1739 1785192 1784698 495 - 122 5 2: 23 2   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|NWMN_1607, protein_id|YP_001332641.1, gi|151221819, geneID|5330943
1740 1786060 1785290 771 - 97         Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43   2: 22 18   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1 15 6: 16 11 12 1 21 4   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73 8 2: 9 1   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946
1745 1790669 1791133 465 + 136     1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|NWMN_1612, protein_id|YP_001332646.1, gi|151221824, geneID|5331891
1746 1791377 1791979 603 + 243 8 3: 17 5 1   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|NWMN_1613, protein_id|YP_001332647.1, gi|151221825, geneID|5330947
1747 1792938 1792195 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|NWMN_1614, protein_id|YP_001332648.1, gi|151221826, geneID|5332407

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Guillaume_Thiamin Beaudoin_Guillaume_user tRNA S(4)U 4-thiouridine synthase (former ThiI)
Thiamin_biosynthesis_PanGenomes Smajic_Semra_user tRNA S(4)U 4-thiouridine synthase (former ThiI)


  Protein Sequence

>fig|426430.8.peg.1741 tRNA S(4)U 4-thiouridine synthase (former ThiI)
MKYDHLLVRYGELTLKGSNRKKFVNQLRNNVNKSLKGLDGFVVKGKRDRMYIELEDHADI
NEITYRLSKIFGIKSISPVLKVEKTIEAISAAAIKFAQQFEENSTFKIDVKRADKNFPMD
TYELQRELGGAVLKHFDNISVNVKRPDHEIRVEVRLDAIYMYEEVVPGSGGLPVGTGGKT
LLMLSGGIDSPVAGMEVMRRGVTIEAIHFHSPPFTSDQAKEKVIELTRILAERVGPIKLH
IVPFTELQKQVNKVVHPRYTMTSTRRMMMRVADKLVHQIGALAIVNGENLGQVASQTLHS
MYAINNVTSTPVLRPLLTYDKEEIIIKSKEIGTFETSIQPFEDCCTIFTPKNPVTEPNFD
KVVQYESVFDFEEMINRAVENIETLEITSDYKTIKEQQTNQLINDFL

MD5 = 87e496e46e314c036eefb56dc0136600


  DNA Sequence

>fig|426430.8.peg.1741 tRNA S(4)U 4-thiouridine synthase (former ThiI)
atgaagtatgatcacttgcttgttagatacggggagttaacattaaagggttcaaataga
aagaaatttgtaaatcaattaagaaataatgtaaataagtcattaaaaggacttgatggg
tttgtcgttaaaggcaaacgagatcgtatgtatattgaacttgaagaccatgcagatata
aatgaaataacatatcgattatcaaaaattttcggtattaaatctattagtccagtatta
aaagtagaaaaaacaatagaggcaataagtgcagcggcaattaaatttgcgcagcaattt
gaagaaaacagcacatttaaaattgatgtgaagcgtgccgataaaaatttcccaatggat
acgtatgaattacagcgtgaattgggtggtgcagtattgaagcacttcgacaatatttca
gtgaatgtcaaacgtccagatcatgaaattcgagtggaagttagattagatgcaatttat
atgtatgaagaagttgttccgggttcaggtggattaccagttggtactggtggtaagacg
ttactaatgctttcaggcggtatagactcaccagttgctgggatggaagtgatgagacgt
ggcgtaacaattgaagcgattcatttccatagtccaccatttacaagtgatcaagcaaaa
gaaaaagttattgaattgacacgtattttagctgaacgtgttggaccaattaaattgcat
attgtaccatttacagaattgcaaaaacaggtaaataaagttgtacatccaagatataca
atgacttcaacgagacgtatgatgatgcgtgttgctgataaattagtacatcaaataggg
gctttagctattgtaaatggtgaaaacctagggcaggtagccagtcaaacacttcatagc
atgtatgcaattaataatgtaacttctactcctgtattacgtcctttattaacttacgat
aaagaagaaattattattaaatcgaaagaaattggtacatttgaaacatctattcaacca
tttgaagattgttgtacaattttcacccctaaaaatccagtaaccgaaccaaactttgat
aaggtagtccaatatgaaagtgtctttgattttgaagagatgattaatcgtgctgttgaa
aatattgaaacacttgaaataactagtgattataaaactattaaagaacagcaaacaaac
caattaataaacgactttttataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1741 tRNA S(4)U 4-thiouridine synthase (former ThiI)
aatcacattcaaaatgttgaaccaactgtccatggtggtggtcaagaatatggcgttaga
agtggaacagttaatttgccaaatgatattgcaatggttaaagcgatgaagatagctaat
gaaaactttgaagcattgaatgcatttgttactgagttaaataatgacgtccgtcaattt
ttaaataaatatcatggagtttatattaattcttcaacttcaggttcaccattcgtttta
aatattagttttcctggcgtaaaaggtgaagtattagttaatgctttttcaaaatatgac
attatgatatctacgacaagtgcttgttcatctaaacgtaataaattaaatgaagtattg
gctgcaatgggattatcagacaaatctattgaaggtagtataagattatcatttggggct
actacaactaaagaagatatagcgaggtttaaagaaatatttatcatcatttatgaggaa
attaaggagttgctaaaataatgaagtatgatcacttgcttgttagatacggggagttaa
cattaaagggttcaaatagaaagaaatttgtaaatcaattaagaaataatgtaaataagt
cattaaaaggacttgatgggtttgtcgttaaaggcaaacgagatcgtatgtatattgaac
ttgaagaccatgcagatataaatgaaataacatatcgattatcaaaaattttcggtatta
aatctattagtccagtattaaaagtagaaaaaacaatagaggcaataagtgcagcggcaa
ttaaatttgcgcagcaatttgaagaaaacagcacatttaaaattgatgtgaagcgtgccg
ataaaaatttcccaatggatacgtatgaattacagcgtgaattgggtggtgcagtattga
agcacttcgacaatatttcagtgaatgtcaaacgtccagatcatgaaattcgagtggaag
ttagattagatgcaatttatatgtatgaagaagttgttccgggttcaggtggattaccag
ttggtactggtggtaagacgttactaatgctttcaggcggtatagactcaccagttgctg
ggatggaagtgatgagacgtggcgtaacaattgaagcgattcatttccatagtccaccat
ttacaagtgatcaagcaaaagaaaaagttattgaattgacacgtattttagctgaacgtg
ttggaccaattaaattgcatattgtaccatttacagaattgcaaaaacaggtaaataaag
ttgtacatccaagatatacaatgacttcaacgagacgtatgatgatgcgtgttgctgata
aattagtacatcaaataggggctttagctattgtaaatggtgaaaacctagggcaggtag
ccagtcaaacacttcatagcatgtatgcaattaataatgtaacttctactcctgtattac
gtcctttattaacttacgataaagaagaaattattattaaatcgaaagaaattggtacat
ttgaaacatctattcaaccatttgaagattgttgtacaattttcacccctaaaaatccag
taaccgaaccaaactttgataaggtagtccaatatgaaagtgtctttgattttgaagaga
tgattaatcgtgctgttgaaaatattgaaacacttgaaataactagtgattataaaacta
ttaaagaacagcaaacaaaccaattaataaacgactttttataaataaaatcctagagta
aatttaaacataaggggatgttaaactatggatttgaacttaacgatgattataatcata
attttatttggttttatcgcggcgtttatagattcggttgtagggggtggcggtttaatt
tctacgccagcattattagcaatcggtctaccaccatctgtggctttaggtacaaataaa
ttggcaagttcgtttggttctttaactagtacgataaagtttataaggtccggtaaagtg
gacttatatgttgttgccaaattatttggttttgtatttttggcatctgcatgtggcgca
tatattgcaacgatggttccgtcacaaatattgaaacctttaatcatcattgcactttcg
tcggtgtttatattcacattacttaaaaaagattggggcaatacacgcacgtttactcaa
tttacatttaagaaagccataatatttgcagcactttttatattaatcggcttttatgat
ggat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003723       F:RNA binding
GO:0005737       C:cytoplasm
GO:0009228       P:thiamin biosynthetic process
cmr|NT05SA1625 Staphylococcus aureus NCTC 8325     thiamine biosynthesis/tRNA modification protein ThiI
cmr|SACOL1764 Staphylococcus aureus subsp. aureus COL     thiamine biosynthesis protein ThiI
cmr|SAUSA300_1661 Staphylococcus aureus subsp. aureus USA300-FPR3757     thiamine biosynthesis protein ThiI
dbj|BAF67881.1 Staphylococcus aureus subsp. aureus str. Newman     thiamine biosynthesis protein ThiI
fig|367830.3.peg.1003 Staphylococcus aureus subsp. aureus USA300 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|426430.6.peg.1560 Staphylococcus aureus subsp. aureus str. Newman FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|451515.3.peg.1812 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|451516.9.peg.1801 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|452948.4.peg.838 Staphylococcus aureus 930918-3 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|455227.3.peg.1059 Staphylococcus aureus D30 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|546342.3.peg.933 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|546343.3.peg.2411 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|553590.4.peg.1936 Staphylococcus aureus A9754 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|553594.3.peg.1811 Staphylococcus aureus A9765 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|644279.4.peg.1860 Staphylococcus aureus subsp. aureus 132 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|93061.3.peg.1658 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|93061.5.peg.1663 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
fig|93062.4.peg.431 Staphylococcus aureus subsp. aureus COL FIG   tRNA S(4)U 4-thiouridine synthase (former ThiI)
gb|AAW38293.1 Staphylococcus aureus subsp. aureus COL     thiamine biosynthesis protein ThiI
gb|ABD20954.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     thiamine biosynthesis protein ThiI
gb|ABD30892.1 Staphylococcus aureus subsp. aureus NCTC 8325     thiamine biosynthesis protein ThiI
gb|ABX29709.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     thiamine biosynthesis protein
gb|EEW45322.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0463
gb|EEW47410.1 Staphylococcus aureus D30     hypothetical protein SAD30_2234
gi|122539305 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable thiamine biosynthesis protein thiI
gi|123485452 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable thiamine biosynthesis protein thiI
gi|150374621 Staphylococcus aureus subsp. aureus str. Newman NCBI   thiamine biosynthesis protein ThiI
gi|151221821 Staphylococcus aureus subsp. aureus str. Newman NCBI   thiamine biosynthesis protein ThiI
gi|160368738 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   thiamine biosynthesis protein
gi|161509929 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   thiamine biosynthesis protein
gi|189030659 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable thiamine biosynthesis protein thiI
gi|189030660 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable thiamine biosynthesis protein thiI
gi|221137946 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   thiamine biosynthesis protein ThiI
gi|221142350 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   thiamine biosynthesis protein ThiI
gi|259160295 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0463
gi|259162846 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2234
gi|57286199 Staphylococcus aureus subsp. aureus COL NCBI   thiamine biosynthesis protein ThiI
gi|57652013 Staphylococcus aureus subsp. aureus COL NCBI   thiamine biosynthesis protein ThiI
gi|71153653 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable thiamine biosynthesis protein thiI
gi|87126440 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   thiamine biosynthesis protein ThiI
gi|87160466 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   thiamine biosynthesis protein ThiI
gi|87203082 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   thiamine biosynthesis protein ThiI
gi|88195524 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   thiamine biosynthesis protein ThiI
img|637152498 Staphylococcus aureus aureus COL IMG   thiamine biosynthesis protein ThiI
img|637888310 Staphylococcus aureus aureus USA300 IMG   thiamine biosynthesis protein ThiI
img|637894423 Staphylococcus aureus aureus NCTC 8325 IMG   thiamine biosynthesis protein ThiI
img|640795990 Staphylococcus aureus aureus Newman IMG   thiamine biosynthesis protein ThiI
img|641309662 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   thiamine biosynthesis protein
img|641771638 Staphylococcus aureus aureus USA300_TCH959 IMG   thiamine biosynthesis protein
kegg|saa:SAUSA300_1661 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   thiamine biosynthesis protein ThiI
kegg|sac:SACOL1764 Staphylococcus aureus subsp. aureus COL KEGG   thiamine biosynthesis protein ThiI
kegg|sae:NWMN_1609 Staphylococcus aureus subsp. aureus Newman KEGG   thiamine biosynthesis protein ThiI
kegg|sao:SAOUHSC_01824 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   thiamine biosynthesis protein ThiI
kegg|sax:USA300HOU_1702 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   thiamine biosynthesis protein ThiI
ref|YP_001332643.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   thiamine biosynthesis protein ThiI
ref|YP_001575588.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   thiamine biosynthesis protein
ref|YP_186598.1 Staphylococcus aureus subsp. aureus COL RefSeq   thiamine biosynthesis protein ThiI
ref|YP_494355.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   thiamine biosynthesis protein ThiI
ref|YP_500329.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   thiamine biosynthesis protein ThiI
ref|ZP_03562748.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   thiamine biosynthesis protein ThiI
ref|ZP_03566843.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   thiamine biosynthesis protein ThiI
sp|A6QHP9 Staphylococcus aureus (strain Newman) SwissProt   Probable thiamine biosynthesis protein thiI
sp|A8Z2N1 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Probable thiamine biosynthesis protein thiI
sp|Q2FG23 Staphylococcus aureus (strain USA300) SwissProt   Probable thiamine biosynthesis protein thiI
sp|Q2FXL1 Staphylococcus aureus (strain NCTC 8325) SwissProt   Probable thiamine biosynthesis protein thiI
sp|Q5HF59 Staphylococcus aureus (strain COL) SwissProt   Probable thiamine biosynthesis protein thiI
sp|THII_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable thiamine biosynthesis protein thiI
sp|THII_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable thiamine biosynthesis protein thiI
sp|THII_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable thiamine biosynthesis protein thiI
sp|THII_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable thiamine biosynthesis protein thiI
sp|THII_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable thiamine biosynthesis protein thiI


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|426430.8.peg.1739 Thiol peroxidase, Tpx-type (EC 1.11.1.15)
15 fig|426430.8.peg.1742 Cysteine desulfurase (EC 2.8.1.7)
8 fig|426430.8.peg.1744 Septation ring formation regulator EzrA
8 fig|426430.8.peg.1746 SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search