The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1740: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Putative membrane protein YfcA
Translate Function Assignments



Context on contig NC_009641 from base 1780333 to 1791133 (10801 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1735 1781451 1780333 1119 -       3: 12 3 5   Alanine dehydrogenase (EC 1.4.1.1) gene_name|ald, locus|NWMN_1603, protein_id|YP_001332637.1, gi|151221815, geneID|5330941
1736 1781592 1782092 501 + 140     2: 9 3   Universal stress protein family locus|NWMN_1604, protein_id|YP_001332638.1, gi|151221816, geneID|5331728
1737 1783540 1782338 1203 - 245     6: 13 7 14 16 18 2   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|NWMN_1605, protein_id|YP_001332639.1, gi|151221817, geneID|5330942
1738 1784575 1783628 948 - 87     2: 6 2   Adenine-specific methyltransferase (EC 2.1.1.72) locus|NWMN_1606, protein_id|YP_001332640.1, gi|151221818, geneID|5331711
1739 1785192 1784698 495 - 122     2: 21 2   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|NWMN_1607, protein_id|YP_001332641.1, gi|151221819, geneID|5330943
1740 1786060 1785290 771 - 97         Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43     2: 19 17   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1     6: 15 10 11 1 20 4   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73     2: 8 1   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946
1745 1790669 1791133 465 + 136     1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|NWMN_1612, protein_id|YP_001332646.1, gi|151221824, geneID|5331891

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1740 Putative membrane protein YfcA
MDLNLTMIIIIILFGFIAAFIDSVVGGGGLISTPALLAIGLPPSVALGTNKLASSFGSLT
STIKFIRSGKVDLYVVAKLFGFVFLASACGAYIATMVPSQILKPLIIIALSSVFIFTLLK
KDWGNTRTFTQFTFKKAIIFAALFILIGFYDGFVGGGTGSFMLFVLLVFGFDFLSAAGNA
KVLNFASNIGALVLFMVLGQVDYVIGLIMAISMIAGSYAGAHFAIKQGVGYVKVLFIIIT
AILILKNAFDYIQQFV

MD5 = 6867d20135a62880990757d19c8a9e07


  DNA Sequence

>fig|426430.8.peg.1740 Putative membrane protein YfcA
atggatttgaacttaacgatgattataatcataattttatttggttttatcgcggcgttt
atagattcggttgtagggggtggcggtttaatttctacgccagcattattagcaatcggt
ctaccaccatctgtggctttaggtacaaataaattggcaagttcgtttggttctttaact
agtacgataaagtttataaggtccggtaaagtggacttatatgttgttgccaaattattt
ggttttgtatttttggcatctgcatgtggcgcatatattgcaacgatggttccgtcacaa
atattgaaacctttaatcatcattgcactttcgtcggtgtttatattcacattacttaaa
aaagattggggcaatacacgcacgtttactcaatttacatttaagaaagccataatattt
gcagcactttttatattaatcggcttttatgatggatttgtaggtgggggaacaggttca
tttatgctttttgtattgttagtctttggttttgattttttaagtgcagcaggaaatgct
aaagttttgaactttgcttctaatataggtgcgcttgtattatttatggtattaggacaa
gtagattatgtaataggtttaattatggctataagtatgattgctgggtcatatgctggg
gctcattttgctattaaacaaggtgttggttatgtaaaagtattatttattattattact
gctattttaattttaaaaaatgcttttgattatattcaacaatttgtataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1740 Putative membrane protein YfcA
tccaagatatacaatgacttcaacgagacgtatgatgatgcgtgttgctgataaattagt
acatcaaataggggctttagctattgtaaatggtgaaaacctagggcaggtagccagtca
aacacttcatagcatgtatgcaattaataatgtaacttctactcctgtattacgtccttt
attaacttacgataaagaagaaattattattaaatcgaaagaaattggtacatttgaaac
atctattcaaccatttgaagattgttgtacaattttcacccctaaaaatccagtaaccga
accaaactttgataaggtagtccaatatgaaagtgtctttgattttgaagagatgattaa
tcgtgctgttgaaaatattgaaacacttgaaataactagtgattataaaactattaaaga
acagcaaacaaaccaattaataaacgactttttataaataaaatcctagagtaaatttaa
acataaggggatgttaaactatggatttgaacttaacgatgattataatcataattttat
ttggttttatcgcggcgtttatagattcggttgtagggggtggcggtttaatttctacgc
cagcattattagcaatcggtctaccaccatctgtggctttaggtacaaataaattggcaa
gttcgtttggttctttaactagtacgataaagtttataaggtccggtaaagtggacttat
atgttgttgccaaattatttggttttgtatttttggcatctgcatgtggcgcatatattg
caacgatggttccgtcacaaatattgaaacctttaatcatcattgcactttcgtcggtgt
ttatattcacattacttaaaaaagattggggcaatacacgcacgtttactcaatttacat
ttaagaaagccataatatttgcagcactttttatattaatcggcttttatgatggatttg
taggtgggggaacaggttcatttatgctttttgtattgttagtctttggttttgattttt
taagtgcagcaggaaatgctaaagttttgaactttgcttctaatataggtgcgcttgtat
tatttatggtattaggacaagtagattatgtaataggtttaattatggctataagtatga
ttgctgggtcatatgctggggctcattttgctattaaacaaggtgttggttatgtaaaag
tattatttattattattactgctattttaattttaaaaaatgcttttgattatattcaac
aatttgtataaaattaaatttgcttttgattaaagcatgaaaattgtaatcaaaccataa
attgtcgtatgatgtagttagaattttaaaatgcaggaggtcaagtatatgactgaaata
acattcaaaggtggaccaatccacttaaaaggtcaacaaattaatgaaggtgattttgca
cctgattttacagtgttagataatgacttaaatcaagtaacattagcagattatgctggt
aaaaagaaattaattagtgtggtaccatcaattgatacaggtgtttgtgatcagcagact
cgcaaattcaactctgatgcttctaaagaagaggggattgtgcttacaatttcagcagac
ttaccattcgcacaaaaaagatggtgcgcttcagcaggtttagacaatgtcattacatta
agtgaccaccgtgacttatcatttggtgaaaactatggcgttgttatggaagaacttcgc
ttattagctcgtgcagtatttgtattagatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0016021       C:integral to membrane
cmr|NT05SA1624 Staphylococcus aureus NCTC 8325     transporter
cmr|SACOL1763 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_1660 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative membrane protein
dbj|BAF67880.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.1002 Staphylococcus aureus subsp. aureus USA300 FIG   Putative membrane protein YfcA
fig|426430.6.peg.1559 Staphylococcus aureus subsp. aureus str. Newman FIG   Putative membrane protein YfcA
fig|451515.3.peg.1811 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Putative membrane protein YfcA
fig|451516.9.peg.1800 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Putative membrane protein YfcA
fig|452948.4.peg.839 Staphylococcus aureus 930918-3 FIG   Putative membrane protein YfcA
fig|455227.3.peg.1060 Staphylococcus aureus D30 FIG   Putative membrane protein YfcA
fig|546342.3.peg.932 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Putative membrane protein YfcA
fig|546343.3.peg.2410 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Putative membrane protein YfcA
fig|553567.3.peg.382 Staphylococcus aureus A5948 FIG   Putative membrane protein YfcA
fig|553590.4.peg.1935 Staphylococcus aureus A9754 FIG   Putative membrane protein YfcA
fig|553594.3.peg.1810 Staphylococcus aureus A9765 FIG   Putative membrane protein YfcA
fig|93061.3.peg.1657 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Putative membrane protein YfcA
fig|93061.5.peg.1662 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Putative membrane protein YfcA
fig|93062.19.peg.1721 Staphylococcus aureus subsp. aureus COL FIG   Putative membrane protein YfcA
fig|93062.4.peg.430 Staphylococcus aureus subsp. aureus COL FIG   Putative membrane protein YfcA
gb|AAW38292.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22656.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative membrane protein
gb|ABD30891.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29708.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1701
gb|EEV84235.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45321.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0462
gb|EEW47409.1 Staphylococcus aureus D30     hypothetical protein SAD30_2233
gi|150374620 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221820 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1608
gi|160368737 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1701
gi|161509928 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1701
gi|221137945 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_04723
gi|221142349 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_12052
gi|257861427 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258450891 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160294 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0462
gi|259162845 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2233
gi|57286198 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57652012 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1763
gi|87128142 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative membrane protein
gi|87162168 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1660
gi|87203081 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195523 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01823
img|637152497 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637888309 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637894422 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795989 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641309661 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641771639 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1660 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1763 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_1608 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_01823 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_1701 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001332642.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1608
ref|YP_001575587.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1701
ref|YP_186597.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1763
ref|YP_494354.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1660
ref|YP_500328.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01823
ref|ZP_03562747.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_04723
ref|ZP_03566842.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_12052
ref|ZP_05698944.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QHP8 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z2N0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|Q2FG24 Staphylococcus aureus (strain USA300) TrEMBL   Putative membrane protein
tr|Q2FXL2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HF60 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search