The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1739: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Thiol peroxidase, Tpx-type (EC 1.11.1.15)
Translate Function Assignments



Context on contig NC_009641 from base 1778962 to 1790532 (11571 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1734 1778962 1780017 1056 +       1: 1   Proline dipeptidase (EC 3.4.13.9) locus|NWMN_1602, protein_id|YP_001332636.1, gi|151221814, geneID|5330940
1735 1781451 1780333 1119 - 315     3: 13 1 5   Alanine dehydrogenase (EC 1.4.1.1) gene_name|ald, locus|NWMN_1603, protein_id|YP_001332637.1, gi|151221815, geneID|5330941
1736 1781592 1782092 501 + 140     2: 9 1   Universal stress protein family locus|NWMN_1604, protein_id|YP_001332638.1, gi|151221816, geneID|5331728
1737 1783540 1782338 1203 - 245 7 6: 12 7 14 17 18 2   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|NWMN_1605, protein_id|YP_001332639.1, gi|151221817, geneID|5330942
1738 1784575 1783628 948 - 87 8 2: 6 2   Adenine-specific methyltransferase (EC 2.1.1.72) locus|NWMN_1606, protein_id|YP_001332640.1, gi|151221818, geneID|5331711
1739 1785192 1784698 495 - 122   2: 21 2   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|NWMN_1607, protein_id|YP_001332641.1, gi|151221819, geneID|5330943
1740 1786060 1785290 771 - 97         Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43     2: 20 16   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1     6: 15 10 11 3 19 4   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73     2: 8 3   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-257314.1.peg.752 natapili Thiol peroxidase, Tpx-type (EC 1.11.1.15)
Thioredoxin-disulfide_reductase gjo Thiol peroxidase, Tpx-type (EC 1.11.1.15)


  Protein Sequence

>fig|426430.8.peg.1739 Thiol peroxidase, Tpx-type (EC 1.11.1.15)
MTEITFKGGPIHLKGQQINEGDFAPDFTVLDNDLNQVTLADYAGKKKLISVVPSIDTGVC
DQQTRKFNSDASKEEGIVLTISADLPFAQKRWCASAGLDNVITLSDHRDLSFGENYGVVM
EELRLLARAVFVLDADNKVVYKEIVSEGTDFPDFDAALAAYKNI

MD5 = d20c4dcd44085acc1acaa7460da1582a


  DNA Sequence

>fig|426430.8.peg.1739 Thiol peroxidase, Tpx-type (EC 1.11.1.15)
atgactgaaataacattcaaaggtggaccaatccacttaaaaggtcaacaaattaatgaa
ggtgattttgcacctgattttacagtgttagataatgacttaaatcaagtaacattagca
gattatgctggtaaaaagaaattaattagtgtggtaccatcaattgatacaggtgtttgt
gatcagcagactcgcaaattcaactctgatgcttctaaagaagaggggattgtgcttaca
atttcagcagacttaccattcgcacaaaaaagatggtgcgcttcagcaggtttagacaat
gtcattacattaagtgaccaccgtgacttatcatttggtgaaaactatggcgttgttatg
gaagaacttcgcttattagctcgtgcagtatttgtattagatgcagataataaagttgtt
tataaagaaatcgttagtgaaggtactgatttcccagattttgatgctgctttagctgca
tacaaaaatatttaa


  DNA with Flanking Sequence

>fig|426430.8.peg.1739 Thiol peroxidase, Tpx-type (EC 1.11.1.15)
gggcaatacacgcacgtttactcaatttacatttaagaaagccataatatttgcagcact
ttttatattaatcggcttttatgatggatttgtaggtgggggaacaggttcatttatgct
ttttgtattgttagtctttggttttgattttttaagtgcagcaggaaatgctaaagtttt
gaactttgcttctaatataggtgcgcttgtattatttatggtattaggacaagtagatta
tgtaataggtttaattatggctataagtatgattgctgggtcatatgctggggctcattt
tgctattaaacaaggtgttggttatgtaaaagtattatttattattattactgctatttt
aattttaaaaaatgcttttgattatattcaacaatttgtataaaattaaatttgcttttg
attaaagcatgaaaattgtaatcaaaccataaattgtcgtatgatgtagttagaatttta
aaatgcaggaggtcaagtatatgactgaaataacattcaaaggtggaccaatccacttaa
aaggtcaacaaattaatgaaggtgattttgcacctgattttacagtgttagataatgact
taaatcaagtaacattagcagattatgctggtaaaaagaaattaattagtgtggtaccat
caattgatacaggtgtttgtgatcagcagactcgcaaattcaactctgatgcttctaaag
aagaggggattgtgcttacaatttcagcagacttaccattcgcacaaaaaagatggtgcg
cttcagcaggtttagacaatgtcattacattaagtgaccaccgtgacttatcatttggtg
aaaactatggcgttgttatggaagaacttcgcttattagctcgtgcagtatttgtattag
atgcagataataaagttgtttataaagaaatcgttagtgaaggtactgatttcccagatt
ttgatgctgctttagctgcatacaaaaatatttaatcattaaagagataaatcttaaaat
gtatacatcgtgtccatcgttgtcaacagcattaaaatagaattgttttctatgattgct
aagacctatgggcactttttattggagagggacgaatatggcagaacaacaaacaattat
ggaacgcttgtttcatacattagatgaaaaagctaaaacattaaataatgaaaatggcca
aagttttattgaaaatcttgggctagcaatggaacaagtatataccaatgaaagaggatt
gttagaacaatcgacgttacaagatcgacgtaaagcattccaatttgcatatttaagttt
aatgcaggaagaaaagatacaagcaaatcatcaaattacaccagattcaattggattgat
actaggatttttagttgagcgttttatgaacaaccaagaagaattacatattgttgatat
tgcaagtggtgccggtcatttaagtgctactgtaaaagaagtgttacctgaaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008379       F:thioredoxin peroxidase activity
GO:0045454       P:cell redox homeostasis
GO:0055114       P:oxidation reduction
cmr|NT03SA1798 Staphylococcus aureus MW2     thiol peroxidase
cmr|NT05SA1623 Staphylococcus aureus NCTC 8325     alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen
cmr|NT09SA1624 Staphylococcus aureus subsp. aureus MSSA476     thiol peroxidase
cmr|SACOL1762 Staphylococcus aureus subsp. aureus COL     thiol peroxidase, putative
cmr|SAUSA300_1659 Staphylococcus aureus subsp. aureus USA300-FPR3757     thiol peroxidase
dbj|BAB95521.1 Staphylococcus aureus subsp. aureus MW2     MW1656
dbj|BAF67879.1 Staphylococcus aureus subsp. aureus str. Newman     thiol peroxidase
emb|CAG43442.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative thiol peroxidase
fig|196620.1.peg.1656 Staphylococcus aureus subsp. aureus MW2 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|196620.5.peg.1724 Staphylococcus aureus subsp. aureus MW2 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|282459.1.peg.1626 Staphylococcus aureus subsp. aureus MSSA476 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|282459.5.peg.1703 Staphylococcus aureus subsp. aureus MSSA476 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|367830.3.peg.1001 Staphylococcus aureus subsp. aureus USA300 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|426430.6.peg.1558 Staphylococcus aureus subsp. aureus str. Newman FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|451515.3.peg.1810 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|451516.9.peg.1799 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|452948.4.peg.840 Staphylococcus aureus 930918-3 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|455227.3.peg.1061 Staphylococcus aureus D30 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|546342.3.peg.931 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|546343.3.peg.2409 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|548474.3.peg.2182 Staphylococcus aureus subsp. aureus TCH130 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|548475.3.peg.697 Staphylococcus aureus subsp. aureus TCH70 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|553567.3.peg.383 Staphylococcus aureus A5948 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|553590.4.peg.1934 Staphylococcus aureus A9754 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|553594.3.peg.1809 Staphylococcus aureus A9765 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|644279.4.peg.1858 Staphylococcus aureus subsp. aureus 132 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|762962.3.peg.276 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|93061.3.peg.1656 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|93061.5.peg.1661 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|93062.19.peg.1720 Staphylococcus aureus subsp. aureus COL FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
fig|93062.4.peg.429 Staphylococcus aureus subsp. aureus COL FIG   Thiol peroxidase, Tpx-type (EC 1.11.1.15)
gb|AAW38291.1 Staphylococcus aureus subsp. aureus COL     thiol peroxidase, putative
gb|ABD22175.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     thiol peroxidase
gb|ABD30890.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29707.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible peroxiredoxin
gb|EEV84236.1 Staphylococcus aureus A5948     thiol peroxidase
gb|EEW45320.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0461
gb|EEW47408.1 Staphylococcus aureus D30     hypothetical protein SAD30_2232
gi|150374619 Staphylococcus aureus subsp. aureus str. Newman NCBI   thiol peroxidase
gi|151221819 Staphylococcus aureus subsp. aureus str. Newman NCBI   thiol peroxidase
gi|160368736 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible peroxiredoxin
gi|161509927 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   peroxiredoxin
gi|21204825 Staphylococcus aureus subsp. aureus MW2 NCBI   MW1656
gi|21283385 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1656
gi|221137944 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   peroxiredoxin
gi|221142348 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   peroxiredoxin
gi|24212516 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable thiol peroxidase
gi|257861428 Staphylococcus aureus A5948 NCBI   thiol peroxidase
gi|258450892 Staphylococcus aureus A5948 NCBI   thiol peroxidase
gi|259160293 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0461
gi|259162844 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2232
gi|49244981 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative thiol peroxidase
gi|49486538 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative thiol peroxidase
gi|57286197 Staphylococcus aureus subsp. aureus COL NCBI   thiol peroxidase, putative
gi|57652011 Staphylococcus aureus subsp. aureus COL NCBI   thiol peroxidase, putative
gi|60390697 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable thiol peroxidase
gi|81859568 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable thiol peroxidase
gi|87127661 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   thiol peroxidase
gi|87161687 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   thiol peroxidase
gi|87203080 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195522 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01822
img|637152496 Staphylococcus aureus aureus COL IMG   thiol peroxidase, putative
img|637157863 Staphylococcus aureus aureus MSSA476 IMG   putative thiol peroxidase
img|637299420 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888308 Staphylococcus aureus aureus USA300 IMG   thiol peroxidase
img|637894421 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795988 Staphylococcus aureus aureus Newman IMG   thiol peroxidase
img|641309660 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible peroxiredoxin( EC:1.11.1.15 )
img|641771640 Staphylococcus aureus aureus USA300_TCH959 IMG   possible peroxiredoxin
kegg|saa:SAUSA300_1659 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   thiol peroxidase (EC:1.11.1.-)
kegg|sac:SACOL1762 Staphylococcus aureus subsp. aureus COL KEGG   thiol peroxidase
kegg|sae:NWMN_1607 Staphylococcus aureus subsp. aureus Newman KEGG   thiol peroxidase
kegg|sam:MW1656 Staphylococcus aureus subsp. aureus MW2 KEGG   thiol peroxidase
kegg|sao:SAOUHSC_01822 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS1640   KEGG   thiol peroxidase
kegg|sax:USA300HOU_1700 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   thiol peroxidase (EC:1.11.1.15)
ref|NP_646473.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1656
ref|YP_001332641.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   thiol peroxidase
ref|YP_001575586.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   peroxiredoxin
ref|YP_043759.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative thiol peroxidase
ref|YP_186596.1 Staphylococcus aureus subsp. aureus COL RefSeq   thiol peroxidase, putative
ref|YP_494353.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   thiol peroxidase
ref|YP_500327.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01822
ref|ZP_03562746.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   peroxiredoxin
ref|ZP_03566841.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   peroxiredoxin
ref|ZP_05698945.1 Staphylococcus aureus A5948 RefSeq   thiol peroxidase
sp|Q5HF61 Staphylococcus aureus (strain COL) SwissProt   Probable thiol peroxidase
sp|Q6G8L4 Staphylococcus aureus (strain MSSA476) SwissProt   Probable thiol peroxidase
sp|Q8NW51 Staphylococcus aureus (strain MW2) SwissProt   Probable thiol peroxidase
sp|TPX_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable thiol peroxidase
sp|TPX_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable thiol peroxidase
sp|TPX_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable thiol peroxidase
tr|A6QHP7 Staphylococcus aureus (strain Newman) TrEMBL   Thiol peroxidase
tr|A8Z2M9 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible peroxiredoxin
tr|Q2FG25 Staphylococcus aureus (strain USA300) TrEMBL   Thiol peroxidase
tr|Q2FXL3 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|426430.8.peg.1737 Acetate kinase (EC 2.7.2.1)
8 fig|426430.8.peg.1738 Adenine-specific methyltransferase (EC 2.1.1.72)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search