The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1738: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Adenine-specific methyltransferase (EC 2.1.1.72)
Translate Function Assignments



Context on contig NC_009641 from base 1778098 to 1790532 (12435 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1733 1778787 1778098 690 -       1: 1   FIG002379: metal-dependent hydrolase locus|NWMN_1601, protein_id|YP_001332635.1, gi|151221813, geneID|5330939
1734 1778962 1780017 1056 + 174 4 1: 1   Proline dipeptidase (EC 3.4.13.9) locus|NWMN_1602, protein_id|YP_001332636.1, gi|151221814, geneID|5330940
1735 1781451 1780333 1119 - 315     3: 13 1 5   Alanine dehydrogenase (EC 1.4.1.1) gene_name|ald, locus|NWMN_1603, protein_id|YP_001332637.1, gi|151221815, geneID|5330941
1736 1781592 1782092 501 + 140 6 2: 9 1   Universal stress protein family locus|NWMN_1604, protein_id|YP_001332638.1, gi|151221816, geneID|5331728
1737 1783540 1782338 1203 - 245 11 6: 12 7 14 17 18 2   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|NWMN_1605, protein_id|YP_001332639.1, gi|151221817, geneID|5330942
1738 1784575 1783628 948 - 87   2: 6 2   Adenine-specific methyltransferase (EC 2.1.1.72) locus|NWMN_1606, protein_id|YP_001332640.1, gi|151221818, geneID|5331711
1739 1785192 1784698 495 - 122     2: 21 2   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|NWMN_1607, protein_id|YP_001332641.1, gi|151221819, geneID|5330943
1740 1786060 1785290 771 - 97         Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43     2: 20 16   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1     6: 15 10 11 3 19 4   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73     2: 8 3   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-257314.1.peg.752 natapili Adenine-specific methyltransferase (EC 2.1.1.72)
DGQHR-like Joseph_Jennifer_user Adenine-specific methyltransferase (EC 2.1.1.72)


  Protein Sequence

>fig|426430.8.peg.1738 Adenine-specific methyltransferase (EC 2.1.1.72)
MAEQQTIMERLFHTLDEKAKTLNNENGQSFIENLGLAMEQVYTNERGLLEQSTLQDRRKA
FQFAYLSLMQEEKIQANHQITPDSIGLILGFLVERFMNNQEELHIVDIASGAGHLSATVK
EVLPEIAVMHHLIEVDPVLSRVSVHLANFLEIPFDVYPQDAIMPLPLEEADIVIGDFPVG
YYPIDERSKEFKLGFEEGHSYSHYLLIEQAINALKDAGYAFLVVPSNIFTGEHVKQLEKY
IATETEMQAFLNLPPTLFKNEKARKSILILQKKKSGETKPVEVLLANIPDFKIPSQFQGF
MTELNQWMDTNRPKK

MD5 = 7314883a23becc56014130049e35efd0


  DNA Sequence

>fig|426430.8.peg.1738 Adenine-specific methyltransferase (EC 2.1.1.72)
atggcagaacaacaaacaattatggaacgcttgtttcatacattagatgaaaaagctaaa
acattaaataatgaaaatggccaaagttttattgaaaatcttgggctagcaatggaacaa
gtatataccaatgaaagaggattgttagaacaatcgacgttacaagatcgacgtaaagca
ttccaatttgcatatttaagtttaatgcaggaagaaaagatacaagcaaatcatcaaatt
acaccagattcaattggattgatactaggatttttagttgagcgttttatgaacaaccaa
gaagaattacatattgttgatattgcaagtggtgccggtcatttaagtgctactgtaaaa
gaagtgttacctgaaattgcggttatgcatcatttaattgaagttgatccagttttatca
cgtgttagtgtacatttagcaaacttcttagaaattcctttcgatgtgtatcctcaagat
gccatcatgccactaccattagaagaagcagatatcgttattggtgattttccagtaggc
tattatccaattgatgaaagaagtaaggagtttaagctaggttttgaagaaggacatagt
tattcacattatttattaatagaacaagcaataaatgcattaaaagatgctggatatgcc
tttctagtggtaccaagtaatatttttacaggtgaacatgtaaaacagcttgaaaaatat
attgcaacagagacagagatgcaagcatttttaaatttaccaccaactttatttaaaaat
gaaaaagcgcgaaaatctatattaattttacaaaagaaaaaatcgggtgaaacaaagcca
gttgaagtattattggcaaatattcctgatttcaaaattccttcacaatttcaaggattt
atgacagagttaaatcagtggatggacacaaatcgtcctaaaaaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1738 Adenine-specific methyltransferase (EC 2.1.1.72)
gcagattatgctggtaaaaagaaattaattagtgtggtaccatcaattgatacaggtgtt
tgtgatcagcagactcgcaaattcaactctgatgcttctaaagaagaggggattgtgctt
acaatttcagcagacttaccattcgcacaaaaaagatggtgcgcttcagcaggtttagac
aatgtcattacattaagtgaccaccgtgacttatcatttggtgaaaactatggcgttgtt
atggaagaacttcgcttattagctcgtgcagtatttgtattagatgcagataataaagtt
gtttataaagaaatcgttagtgaaggtactgatttcccagattttgatgctgctttagct
gcatacaaaaatatttaatcattaaagagataaatcttaaaatgtatacatcgtgtccat
cgttgtcaacagcattaaaatagaattgttttctatgattgctaagacctatgggcactt
tttattggagagggacgaatatggcagaacaacaaacaattatggaacgcttgtttcata
cattagatgaaaaagctaaaacattaaataatgaaaatggccaaagttttattgaaaatc
ttgggctagcaatggaacaagtatataccaatgaaagaggattgttagaacaatcgacgt
tacaagatcgacgtaaagcattccaatttgcatatttaagtttaatgcaggaagaaaaga
tacaagcaaatcatcaaattacaccagattcaattggattgatactaggatttttagttg
agcgttttatgaacaaccaagaagaattacatattgttgatattgcaagtggtgccggtc
atttaagtgctactgtaaaagaagtgttacctgaaattgcggttatgcatcatttaattg
aagttgatccagttttatcacgtgttagtgtacatttagcaaacttcttagaaattcctt
tcgatgtgtatcctcaagatgccatcatgccactaccattagaagaagcagatatcgtta
ttggtgattttccagtaggctattatccaattgatgaaagaagtaaggagtttaagctag
gttttgaagaaggacatagttattcacattatttattaatagaacaagcaataaatgcat
taaaagatgctggatatgcctttctagtggtaccaagtaatatttttacaggtgaacatg
taaaacagcttgaaaaatatattgcaacagagacagagatgcaagcatttttaaatttac
caccaactttatttaaaaatgaaaaagcgcgaaaatctatattaattttacaaaagaaaa
aatcgggtgaaacaaagccagttgaagtattattggcaaatattcctgatttcaaaattc
cttcacaatttcaaggatttatgacagagttaaatcagtggatggacacaaatcgtccta
aaaaataatctgtaatagtatagtcataaaactgtatgaatgataaaatgaaaaatgaaa
tagtataaaaagcaaacgatggaggatcattacttatgtcaaaattaatcttggctatca
atgctggtagttcatcattaaaatttcaattaattagaatgcctgaagaggaattagtaa
caaaaggtttagtagaaagaatcggattgaaggattcaatttttacaattgaagtcaacg
gggaaaaagttaaaacagtacaagatatcaaggatcacgttgaggcagttgatatcatgt
tggatgcttttaaagcgcacaatattattaatgatattaacgatatcgatggaacaggtc
accgtgttgtacatggtggtgaaaaattccctgaatcagtagctattactgatgaggttg
aaaaggaaattgaagaattaagcgaattagcaccgcttcacaacccagctaacttgatgg
gtattcgtgctttccgtaaattattacc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SA1797 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA1622 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|NT09SA1623 Staphylococcus aureus subsp. aureus MSSA476     Adenine-specific methyltransferase
cmr|SACOL1761 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_1658 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB95520.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF67878.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG43441.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
fig|196620.1.peg.1655 Staphylococcus aureus subsp. aureus MW2 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|196620.5.peg.1723 Staphylococcus aureus subsp. aureus MW2 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|282459.1.peg.1625 Staphylococcus aureus subsp. aureus MSSA476 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|282459.5.peg.1702 Staphylococcus aureus subsp. aureus MSSA476 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|367830.3.peg.1000 Staphylococcus aureus subsp. aureus USA300 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|426430.6.peg.1557 Staphylococcus aureus subsp. aureus str. Newman FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|451515.3.peg.1809 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|451516.9.peg.1798 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|452948.4.peg.841 Staphylococcus aureus 930918-3 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|455227.3.peg.1062 Staphylococcus aureus D30 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|546342.3.peg.930 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|546343.3.peg.2408 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|548475.3.peg.696 Staphylococcus aureus subsp. aureus TCH70 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|553567.3.peg.384 Staphylococcus aureus A5948 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|553590.4.peg.1933 Staphylococcus aureus A9754 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|553594.3.peg.1808 Staphylococcus aureus A9765 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|644279.4.peg.1857 Staphylococcus aureus subsp. aureus 132 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|762962.3.peg.277 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|93061.3.peg.1655 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|93061.5.peg.1660 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|93062.19.peg.1719 Staphylococcus aureus subsp. aureus COL FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
fig|93062.4.peg.428 Staphylococcus aureus subsp. aureus COL FIG   Adenine-specific methyltransferase (EC 2.1.1.72)
gb|AAW38290.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21099.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30889.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29706.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1699
gb|EEV84237.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45319.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0460
gb|EEW47407.1 Staphylococcus aureus D30     hypothetical protein SAD30_2231
gi|150374618 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221818 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1606
gi|160368735 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1699
gi|161509926 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1699
gi|21204824 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21283384 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1655
gi|221137943 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_04713
gi|221142347 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_12042
gi|257861429 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258450893 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160292 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0460
gi|259162843 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2231
gi|49244980 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49486537 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1639
gi|57286196 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57652010 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1761
gi|87126585 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160611 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1658
gi|87203079 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195521 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01821
img|637152495 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637157862 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637299419 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888307 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637894420 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795987 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641309659 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641771641 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1658 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1761 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_1606 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW1655 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01821 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS1639   KEGG   hypothetical protein
kegg|sax:USA300HOU_1699 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_646472.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1655
ref|YP_001332640.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1606
ref|YP_001575585.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1699
ref|YP_043758.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1639
ref|YP_186595.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1761
ref|YP_494352.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1658
ref|YP_500326.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01821
ref|ZP_03562745.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_04713
ref|ZP_03566840.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_12042
ref|ZP_05698946.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QHP6 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z2M8 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|Q2FG26 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FXL4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HF62 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6G8L5 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q8NW52 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW1655


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|426430.8.peg.1734 Proline dipeptidase (EC 3.4.13.9)
6 fig|426430.8.peg.1736 Universal stress protein family
11 fig|426430.8.peg.1737 Acetate kinase (EC 2.7.2.1)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search