The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1737: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Acetate kinase (EC 2.7.2.1)
Translate Function Assignments



Context on contig NC_009641 from base 1777380 to 1788493 (11114 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1732 1777380 1777793 414 +       2: 3 1   Universal stress protein family locus|NWMN_1600, protein_id|YP_001332634.1, gi|151221812, geneID|5330938
1733 1778787 1778098 690 - 304     1: 1   FIG002379: metal-dependent hydrolase locus|NWMN_1601, protein_id|YP_001332635.1, gi|151221813, geneID|5330939
1734 1778962 1780017 1056 + 174     1: 1   Proline dipeptidase (EC 3.4.13.9) locus|NWMN_1602, protein_id|YP_001332636.1, gi|151221814, geneID|5330940
1735 1781451 1780333 1119 - 315     3: 9 1 4   Alanine dehydrogenase (EC 1.4.1.1) gene_name|ald, locus|NWMN_1603, protein_id|YP_001332637.1, gi|151221815, geneID|5330941
1736 1781592 1782092 501 + 140 4 2: 3 1   Universal stress protein family locus|NWMN_1604, protein_id|YP_001332638.1, gi|151221816, geneID|5331728
1737 1783540 1782338 1203 - 245   6: 8 6 16 17 18 2   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|NWMN_1605, protein_id|YP_001332639.1, gi|151221817, geneID|5330942
1738 1784575 1783628 948 - 87 6 2: 14 2   Adenine-specific methyltransferase (EC 2.1.1.72) locus|NWMN_1606, protein_id|YP_001332640.1, gi|151221818, geneID|5331711
1739 1785192 1784698 495 - 122     2: 12 2   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|NWMN_1607, protein_id|YP_001332641.1, gi|151221819, geneID|5330943
1740 1786060 1785290 771 - 97         Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43     2: 20 11   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1     6: 10 7 15 5 19 13   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-257314.1.peg.752 natapili Acetate kinase (EC 2.7.2.1)
Fermentations:_Mixed_acid SvetaG Acetate kinase (EC 2.7.2.1)
Lysine_fermentation gjo Acetate kinase (EC 2.7.2.1)
Fermentations:_Lactate SvetaG Acetate kinase (EC 2.7.2.1)
Pyruvate_metabolism_II:_acetyl-CoA,_acetogenesis_from_pyruvate SvetaG Acetate kinase (EC 2.7.2.1)
Lysine_fermentation_exploration ZALLOT_Remi_user Acetate kinase (EC 2.7.2.1)


  Protein Sequence

>fig|426430.8.peg.1737 Acetate kinase (EC 2.7.2.1)
MSKLILAINAGSSSLKFQLIRMPEEELVTKGLVERIGLKDSIFTIEVNGEKVKTVQDIKD
HVEAVDIMLDAFKAHNIINDINDIDGTGHRVVHGGEKFPESVAITDEVEKEIEELSELAP
LHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHG
TSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTR
SGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMA
LDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNEN
LLRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTFGGLK

MD5 = 6641866577fde40a8ecb67126dfc033a


  DNA Sequence

>fig|426430.8.peg.1737 Acetate kinase (EC 2.7.2.1)
atgtcaaaattaatcttggctatcaatgctggtagttcatcattaaaatttcaattaatt
agaatgcctgaagaggaattagtaacaaaaggtttagtagaaagaatcggattgaaggat
tcaatttttacaattgaagtcaacggggaaaaagttaaaacagtacaagatatcaaggat
cacgttgaggcagttgatatcatgttggatgcttttaaagcgcacaatattattaatgat
attaacgatatcgatggaacaggtcaccgtgttgtacatggtggtgaaaaattccctgaa
tcagtagctattactgatgaggttgaaaaggaaattgaagaattaagcgaattagcaccg
cttcacaacccagctaacttgatgggtattcgtgctttccgtaaattattaccaaatatc
cctcatgtggcaatttttgatacagcattccatcaaacaatgcctgaaaaagcatatcta
tatagcttgccatatcattattataaagattatggcattcgtaagtatggtttccatggt
acaagccataaatttgtatcacaaagagcggcagaaatgttagataagccaattgaagat
ttacgtattatttcatgtcacattggtaatggagcatcaattgcagctatcgatggcggt
aaatctattgatacatcaatgggcttcacaccacttgctggtgtaacaatgggtactcgt
tctggtaatattgaccctgctttaattccatttattatggaaaaaacaggtaaaactgct
gaacaagtattggaaatcttaaacaaagaatcaggtttattaggattatcaggtacatct
agtgatttacgtgacttatcagaagaagctgaatcaggtaaagcacgttcacaaatggct
ttagatgtatttgcttctaaaattcacaaatatattggatcatatgctgcgagaatgcat
ggtgttgatgttatcgtatttacagcaggtatcggtgaaaactcagtagaaattcgtgcg
aaagttcttgaaggcttagaatttatgggtgtttactgggatcctaagaaaaatgaaaac
ttactacgtggtaaagaaggatttattaactatcctcattcaccagttaaagttgtcgtt
attccaacagatgaagaaagtatgattgcccgtgatgttatgacattcggtggtttaaaa
taa


  DNA with Flanking Sequence

>fig|426430.8.peg.1737 Acetate kinase (EC 2.7.2.1)
taggctattatccaattgatgaaagaagtaaggagtttaagctaggttttgaagaaggac
atagttattcacattatttattaatagaacaagcaataaatgcattaaaagatgctggat
atgcctttctagtggtaccaagtaatatttttacaggtgaacatgtaaaacagcttgaaa
aatatattgcaacagagacagagatgcaagcatttttaaatttaccaccaactttattta
aaaatgaaaaagcgcgaaaatctatattaattttacaaaagaaaaaatcgggtgaaacaa
agccagttgaagtattattggcaaatattcctgatttcaaaattccttcacaatttcaag
gatttatgacagagttaaatcagtggatggacacaaatcgtcctaaaaaataatctgtaa
tagtatagtcataaaactgtatgaatgataaaatgaaaaatgaaatagtataaaaagcaa
acgatggaggatcattacttatgtcaaaattaatcttggctatcaatgctggtagttcat
cattaaaatttcaattaattagaatgcctgaagaggaattagtaacaaaaggtttagtag
aaagaatcggattgaaggattcaatttttacaattgaagtcaacggggaaaaagttaaaa
cagtacaagatatcaaggatcacgttgaggcagttgatatcatgttggatgcttttaaag
cgcacaatattattaatgatattaacgatatcgatggaacaggtcaccgtgttgtacatg
gtggtgaaaaattccctgaatcagtagctattactgatgaggttgaaaaggaaattgaag
aattaagcgaattagcaccgcttcacaacccagctaacttgatgggtattcgtgctttcc
gtaaattattaccaaatatccctcatgtggcaatttttgatacagcattccatcaaacaa
tgcctgaaaaagcatatctatatagcttgccatatcattattataaagattatggcattc
gtaagtatggtttccatggtacaagccataaatttgtatcacaaagagcggcagaaatgt
tagataagccaattgaagatttacgtattatttcatgtcacattggtaatggagcatcaa
ttgcagctatcgatggcggtaaatctattgatacatcaatgggcttcacaccacttgctg
gtgtaacaatgggtactcgttctggtaatattgaccctgctttaattccatttattatgg
aaaaaacaggtaaaactgctgaacaagtattggaaatcttaaacaaagaatcaggtttat
taggattatcaggtacatctagtgatttacgtgacttatcagaagaagctgaatcaggta
aagcacgttcacaaatggctttagatgtatttgcttctaaaattcacaaatatattggat
catatgctgcgagaatgcatggtgttgatgttatcgtatttacagcaggtatcggtgaaa
actcagtagaaattcgtgcgaaagttcttgaaggcttagaatttatgggtgtttactggg
atcctaagaaaaatgaaaacttactacgtggtaaagaaggatttattaactatcctcatt
caccagttaaagttgtcgttattccaacagatgaagaaagtatgattgcccgtgatgtta
tgacattcggtggtttaaaataatttttaaataaatattaagcgtctatctccgctacaa
ttatatgtaggaggtagacgctttttgtattgtttgaaaattaactagtgtaatgtctct
tttcacgaatatcttaaagaattaagtagtcgaagaagattatgaaaacattattaagtg
agttttatttataaacaataaaaaaccaagtgcagaaagttgcacttggttcataatgat
caagtagttatctaatgatcatctatatttaattttgatatttttcacgtaattgagttg
ttgcaacttgtggttggaagtctgctggtaactcttcagtacgaacaactaacacgtcac
atggcgcatgacgaacgatagattctgatacagaaccaacaataaatctttccacggcat
ttaagcctgatgtaccactcataatcaagtctgcattaatttcatgtgcaagctttttag
gaatgatagatttaggagagccaaactctagacgcgtttctac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005524       F:ATP binding
GO:0005737       C:cytoplasm
GO:0006082       P:organic acid metabolic process
GO:0008776       F:acetate kinase activity
GO:0016310       P:phosphorylation
cmr|NT03SA1796 Staphylococcus aureus MW2     acetate kinase
cmr|NT05SA1621 Staphylococcus aureus NCTC 8325     acetate kinase
cmr|NT09SA1622 Staphylococcus aureus subsp. aureus MSSA476     acetate kinase
cmr|NT11SA1591 Staphylococcus aureus RF122     acetate kinase
cmr|SACOL1760 Staphylococcus aureus subsp. aureus COL     acetate kinase
cmr|SAUSA300_1657 Staphylococcus aureus subsp. aureus USA300-FPR3757     acetate kinase
dbj|BAB95519.1 Staphylococcus aureus subsp. aureus MW2     ackA
dbj|BAF67877.1 Staphylococcus aureus subsp. aureus str. Newman     acetate kinase
emb|CAG43440.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   acetate kinase
emb|CAI81259.1 Staphylococcus aureus RF122 EMBL   acetate kinase
fig|196620.1.peg.1654 Staphylococcus aureus subsp. aureus MW2 FIG   Acetate kinase (EC 2.7.2.1)
fig|196620.5.peg.1722 Staphylococcus aureus subsp. aureus MW2 FIG   Acetate kinase (EC 2.7.2.1)
fig|273036.3.peg.1553 Staphylococcus aureus RF122 FIG   Acetate kinase (EC 2.7.2.1)
fig|273036.6.peg.1666 Staphylococcus aureus RF122 FIG   Acetate kinase (EC 2.7.2.1)
fig|282459.1.peg.1624 Staphylococcus aureus subsp. aureus MSSA476 FIG   Acetate kinase (EC 2.7.2.1)
fig|282459.5.peg.1701 Staphylococcus aureus subsp. aureus MSSA476 FIG   Acetate kinase (EC 2.7.2.1)
fig|367830.3.peg.1179 Staphylococcus aureus subsp. aureus USA300 FIG   Acetate kinase (EC 2.7.2.1)
fig|426430.6.peg.1556 Staphylococcus aureus subsp. aureus str. Newman FIG   Acetate kinase (EC 2.7.2.1)
fig|451515.3.peg.1808 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Acetate kinase (EC 2.7.2.1)
fig|451516.9.peg.1797 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Acetate kinase (EC 2.7.2.1)
fig|455227.3.peg.1063 Staphylococcus aureus D30 FIG   Acetate kinase (EC 2.7.2.1)
fig|546342.3.peg.929 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Acetate kinase (EC 2.7.2.1)
fig|546343.3.peg.2407 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Acetate kinase (EC 2.7.2.1)
fig|548475.3.peg.695 Staphylococcus aureus subsp. aureus TCH70 FIG   Acetate kinase (EC 2.7.2.1)
fig|553567.3.peg.385 Staphylococcus aureus A5948 FIG   Acetate kinase (EC 2.7.2.1)
fig|553590.4.peg.1932 Staphylococcus aureus A9754 FIG   Acetate kinase (EC 2.7.2.1)
fig|553594.3.peg.1807 Staphylococcus aureus A9765 FIG   Acetate kinase (EC 2.7.2.1)
fig|585152.3.peg.1702 Staphylococcus aureus subsp. aureus D139 FIG   Acetate kinase (EC 2.7.2.1)
fig|585155.3.peg.1943 Staphylococcus aureus subsp. aureus H19 FIG   Acetate kinase (EC 2.7.2.1)
fig|644279.4.peg.1856 Staphylococcus aureus subsp. aureus 132 FIG   Acetate kinase (EC 2.7.2.1)
fig|762962.3.peg.278 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Acetate kinase (EC 2.7.2.1)
fig|93061.3.peg.1654 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Acetate kinase (EC 2.7.2.1)
fig|93061.5.peg.1659 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Acetate kinase (EC 2.7.2.1)
fig|93062.19.peg.1718 Staphylococcus aureus subsp. aureus COL FIG   Acetate kinase (EC 2.7.2.1)
fig|93062.4.peg.427 Staphylococcus aureus subsp. aureus COL FIG   Acetate kinase (EC 2.7.2.1)
gb|AAW38289.1 Staphylococcus aureus subsp. aureus COL     acetate kinase
gb|ABD20455.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     acetate kinase
gb|ABD30888.1 Staphylococcus aureus subsp. aureus NCTC 8325     acetate kinase
gb|ABX29705.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     acetate kinase
gb|EES54467.1 Staphylococcus aureus subsp. aureus TCH70     acetate kinase
gb|EEV84238.1 Staphylococcus aureus A5948     acetate kinase
gb|EEW47406.1 Staphylococcus aureus D30     acetate/propionate kinase
gi|122539308 organism not parsed/found in ncbi nr NCBI   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
gi|123485455 organism not parsed/found in ncbi nr NCBI   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
gi|123547902 organism not parsed/found in ncbi nr NCBI   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
gi|150374617 Staphylococcus aureus subsp. aureus str. Newman NCBI   acetate kinase
gi|151221817 Staphylococcus aureus subsp. aureus str. Newman NCBI   acetate kinase
gi|160368734 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   acetate kinase
gi|161509925 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   acetate kinase
gi|172048945 organism not parsed/found in ncbi nr NCBI   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
gi|189027311 organism not parsed/found in ncbi nr NCBI   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
gi|21204823 Staphylococcus aureus subsp. aureus MW2 NCBI   ackA
gi|21283383 Staphylococcus aureus subsp. aureus MW2 NCBI   acetate kinase
gi|221137942 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   acetate kinase
gi|221142346 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   acetate kinase
gi|25008046 organism not parsed/found in ncbi nr NCBI   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
gi|251801810 Staphylococcus aureus subsp. aureus TCH70 NCBI   acetate kinase
gi|251814701 Staphylococcus aureus subsp. aureus TCH70 NCBI   acetate kinase
gi|257861430 Staphylococcus aureus A5948 NCBI   acetate kinase
gi|258450894 Staphylococcus aureus A5948 NCBI   acetate kinase
gi|259162842 Staphylococcus aureus D30 NCBI   acetate/propionate kinase
gi|49244979 Staphylococcus aureus subsp. aureus MSSA476 NCBI   acetate kinase
gi|49486536 Staphylococcus aureus subsp. aureus MSSA476 NCBI   acetate kinase
gi|56748577 organism not parsed/found in ncbi nr NCBI   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
gi|57286195 Staphylococcus aureus subsp. aureus COL NCBI   acetate kinase
gi|57652009 Staphylococcus aureus subsp. aureus COL NCBI   acetate kinase
gi|71152221 organism not parsed/found in ncbi nr NCBI   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
gi|82656830 Staphylococcus aureus RF122 NCBI   acetate kinase
gi|82751299 Staphylococcus aureus RF122 NCBI   acetate kinase
gi|87125941 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   acetate kinase
gi|87159967 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   acetate kinase
gi|87203078 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   acetate kinase
gi|88195520 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   acetate kinase
img|637152494 Staphylococcus aureus aureus COL IMG   acetate/propionate kinase( EC:2.7.2.1 )
img|637157861 Staphylococcus aureus aureus MSSA476 IMG   acetate/propionate kinase( EC:2.7.2.1 )
img|637299418 Staphylococcus aureus aureus MW2 IMG   acetate/propionate kinase( EC:2.7.2.1 )
img|637816511 Staphylococcus aureus RF122 IMG   acetate kinase( EC:2.7.2.1 )
img|637888306 Staphylococcus aureus aureus USA300 IMG   acetate kinase( EC:2.7.2.1 )
img|637894419 Staphylococcus aureus aureus NCTC 8325 IMG   acetate kinase( EC:2.7.2.1 )
img|640795986 Staphylococcus aureus aureus Newman IMG   acetate kinase( EC:2.7.2.1 )
img|641309658 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   acetate kinase( EC:2.7.2.1 )
kegg|saa:SAUSA300_1657 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   acetate kinase (EC:2.7.2.1)
kegg|sab:SAB1570c Staphylococcus aureus RF122 KEGG   acetate kinase (EC:2.7.2.1)
kegg|sac:SACOL1760 Staphylococcus aureus subsp. aureus COL KEGG   acetate kinase (EC:2.7.2.1)
kegg|sae:NWMN_1605 Staphylococcus aureus subsp. aureus Newman KEGG   acetate kinase (EC:2.7.2.1)
kegg|sam:MW1654 Staphylococcus aureus subsp. aureus MW2 KEGG   acetate kinase (EC:2.7.2.1)
kegg|sao:SAOUHSC_01820 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   acetate kinase (EC:2.7.2.1)
kegg|sas:SAS1638   KEGG   acetate kinase (EC:2.7.2.1)
kegg|sax:USA300HOU_1698 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   acetate kinase (EC:2.7.2.1)
ref|NP_646471.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   acetate kinase
ref|YP_001332639.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   acetate kinase
ref|YP_001575584.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   acetate kinase
ref|YP_043757.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   acetate kinase
ref|YP_186594.1 Staphylococcus aureus subsp. aureus COL RefSeq   acetate kinase
ref|YP_417040.1 Staphylococcus aureus RF122 RefSeq   acetate kinase
ref|YP_494351.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   acetate kinase
ref|YP_500325.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   acetate kinase
ref|ZP_03562744.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   acetate kinase
ref|ZP_03566839.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   acetate kinase
ref|ZP_04829174.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   acetate kinase
ref|ZP_05698947.1 Staphylococcus aureus A5948 RefSeq   acetate kinase
sp|A6QHP5 Staphylococcus aureus (strain Newman) SwissProt   Acetate kinase
sp|A8Z2M7 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Acetate kinase
sp|ACKA_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
sp|ACKA_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
sp|ACKA_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
sp|ACKA_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
sp|ACKA_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
sp|ACKA_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
sp|ACKA_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
sp|ACKA_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Acetate kinase; AltName: Full=Acetokinase
sp|Q2FG27 Staphylococcus aureus (strain USA300) SwissProt   Acetate kinase
sp|Q2FXL5 Staphylococcus aureus (strain NCTC 8325) SwissProt   Acetate kinase
sp|Q2YTC9 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   Acetate kinase
sp|Q5HF63 Staphylococcus aureus (strain COL) SwissProt   Acetate kinase
sp|Q6G8L6 Staphylococcus aureus (strain MSSA476) SwissProt   Acetate kinase
sp|Q8NW53 Staphylococcus aureus (strain MW2) SwissProt   Acetate kinase
tr|C5QK58 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Acetate kinase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|426430.8.peg.1736 Universal stress protein family
6 fig|426430.8.peg.1738 Adenine-specific methyltransferase (EC 2.1.1.72)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search