The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|418127.6.peg.870: Staphylococcus aureus subsp. aureus Mu3

This feature in The SEED Viewer

NCBI Taxonomy Id: 418127

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_009782 from base 917487 to 928354 (10868 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
862 917487 918884 1398 +       1: 2   Iron-sulfur cluster assembly protein SufB locus|SAHV_0842, protein_id|YP_001441432.1, gi|156979173, geneID|5560331
863 920001 918952 1050 - 67 5     Phage integrase gene_name|int, locus|SAHV_0843, protein_id|YP_001441433.1, gi|156979174, geneID|5560311
864 920113 920292 180 + 111         Phage excisionase gene_name|int, locus|SAHV_0844, protein_id|YP_001441434.1, gi|156979175, geneID|5558948
865 921204 920272 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] locus|SAHV_0845, protein_id|YP_001441435.1, gi|156979176, geneID|5559064
866 921709 921236 474 - 31         Phage protein locus|SAHV_0846, protein_id|YP_001441436.1, gi|156979177, geneID|5561439
867 922042 921713 330 - 3         Phage repressor protein cI locus|SAHV_0847, protein_id|YP_001441437.1, gi|156979178, geneID|5561673
868 922483 922626 144 + 440         Phage protein  
869 922825 922616 210 - -11         Phage protein locus|SAHV_0849, protein_id|YP_001441439.1, gi|156979180, geneID|5561601
870 922882 923661 780 + 56       Phage antirepressor protein locus|SAHV_0850, protein_id|YP_001441440.1, gi|156979181, geneID|5560369
871 923662 923886 225 + 0         Phage phi 11 orf8 protein homolog locus|SAHV_0851, protein_id|YP_001441441.1, gi|156979182, geneID|5560249
872 923926 924069 144 + 39         Phage protein locus|SAHV_0852, protein_id|YP_001441442.1, gi|156979183, geneID|5561512
873 924738 924091 648 - 21         Phage protein locus|SAHV_0853, protein_id|YP_001441443.1, gi|156979184, geneID|5561659
874 925023 925184 162 + 284         Phage phi 11 orf10a protein homolog  
875 925277 925579 303 + 92         Phage protein locus|SAHV_0855, protein_id|YP_001441445.1, gi|156979186, geneID|5559122
876 925584 925844 261 + 4         Phage phi 11 orf11 protein homolog  
877 925854 926075 222 + 9         Phage phi-ETA orf16 protein homolog locus|SAHV_0857, protein_id|YP_001441447.1, gi|156979188, geneID|5561372
878 926114 926692 579 + 38         Phage protein  
879 926692 927117 426 + -1     1: 1   Phage ssDNA binding protein locus|SAHV_0859, protein_id|YP_001441449.1, gi|156979190, geneID|5559144
880 927128 927679 552 + 10         Phage HNH endonuclease locus|SAHV_0860, protein_id|YP_001441450.1, gi|156979191, geneID|5561684
881 927680 928354 675 + 0         Phage phi 11 orf14 protein homolog locus|SAHV_0861, protein_id|YP_001441451.1, gi|156979192, geneID|5559078

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|418127.6.peg.870 Phage antirepressor protein
MQALQTFNFEELPVRTLEVDGEPYFIGKDVADILGYANGRDALSKHVDEDDKKVLTSRNT
TLENLPNRGLTAVNESGLYSLIFSSKLESAKRFKRWVTSDVLPAIRKYGIYATDNVIEQT
LKDPDYIITVLTEYKKEKEQNLLLQQEIGELKPKADYVDEILKSTGTLATTQIAADYGIS
AQKLNKLLHEARLQRKVNKQWVLYSEHMGKSYTDSDTITIVRSDGREDTVLQTRWTQKGR
LKIHEIMTEFGYEANLGGA

MD5 = edb6840cea7ca7963f637b6a02f87e1a


  DNA Sequence

>fig|418127.6.peg.870 Phage antirepressor protein
atgcaagcattacaaacatttaattttgaagaattaccagtaagaacattagaggttgac
ggagaaccatattttataggaaaagatgttgctgacattttaggatatgcaaacggacga
gatgctttgtcaaaacatgttgatgaagacgacaagaaagttctaacgtcgcgaaatacg
actttagaaaatttaccaaatcgaggacttactgcagtcaacgaatcgggtttatacagc
ctaatcttctcatcaaaactagaatcagctaaacgattcaaacgctgggtaacatcagat
gtcctaccagccattcgcaaatatggtatctacgcaacggacaacgtaattgaacaaaca
ttaaaagatccagactacatcattacagtgttgactgagtataagaaagaaaaagagcaa
aacttacttttgcaacaagaaatcggagagctaaaacccaaagcagattatgttgatgaa
atcttaaaatcaactggcacattagctacaactcaaatcgcggcagactacggtatatca
gcacaaaagttaaacaaactactacacgaagctagactacaacgaaaagtaaataaacag
tgggtgctttactcagaacacatgggcaagagttacacagattcagacactataacaatt
gtgcgttctgatggcagagaagacacagttttacaaactagatggacacaaaaaggcaga
ttgaaaatacatgaaatcatgactgaattcggttatgaagctaatttagggggagcgtaa


  DNA with Flanking Sequence

>fig|418127.6.peg.870 Phage antirepressor protein
gataaaggtctaaatttttttgaccttcgtataactttttataacttttaggtaatgtaa
caaatggacataaacaaagatcttaaaaggaggaataacaaatgttacaaaaatttagaa
tcgctaaagaaaaaagtaaattaaaactcaatttactaaaacatgcaaacagtaatttag
aaacaagaaacaaccctgaactgttgcgagcagttgcagagttgcttaaagagattaatc
gataaattctatgaattcgattttagctgaagcgatagctactattttgtctccaacaaa
agtatatgagccattagtgaacaaggaacttttaattttttcttttgatatttcaacagt
tccgcgatgacctgactttatcactttttctaaattatcgatttcaacaaatttatcatt
agaaagatataaacaagctttcatacttatcacctccttaggttgataacaacattatac
acgaaaggagcataaacattatgcaagcattacaaacatttaattttgaagaattaccag
taagaacattagaggttgacggagaaccatattttataggaaaagatgttgctgacattt
taggatatgcaaacggacgagatgctttgtcaaaacatgttgatgaagacgacaagaaag
ttctaacgtcgcgaaatacgactttagaaaatttaccaaatcgaggacttactgcagtca
acgaatcgggtttatacagcctaatcttctcatcaaaactagaatcagctaaacgattca
aacgctgggtaacatcagatgtcctaccagccattcgcaaatatggtatctacgcaacgg
acaacgtaattgaacaaacattaaaagatccagactacatcattacagtgttgactgagt
ataagaaagaaaaagagcaaaacttacttttgcaacaagaaatcggagagctaaaaccca
aagcagattatgttgatgaaatcttaaaatcaactggcacattagctacaactcaaatcg
cggcagactacggtatatcagcacaaaagttaaacaaactactacacgaagctagactac
aacgaaaagtaaataaacagtgggtgctttactcagaacacatgggcaagagttacacag
attcagacactataacaattgtgcgttctgatggcagagaagacacagttttacaaacta
gatggacacaaaaaggcagattgaaaatacatgaaatcatgactgaattcggttatgaag
ctaatttagggggagcgtaaatgacaccagaacaaaaagaaaagctaaacaatatagtat
taacactttatgcagttaaagaaaacaaaagtcaaacatacacacacaaagatactctta
ctgtgacatatgcaggcgagattgagcacacttacgaagtcgacagagagaaacaccttg
aatcaatgattgagtgggcaattgaccaaatcgaacagcactttgatttagacgaagaag
aataacacacaattgaacaaacaacttaataggaggaactacaaatgttacaaaaattta
gaatcgctaaagaaaaaagtaaattaaaactcaatttactaaaacatgcaaacagtaatt
tagaaacaagaaacaaccctgaactgttgcgagcagttgcagagttgcttaaagagatta
atcgataaattagagaactaatcatcgtttcagttctcgtcatctaagtaattagcaatt
acgtaaagtgttaaaagagttgctattacattaaaaaaca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT02SA0851 Staphylococcus aureus Mu50     anti-repressor
dbj|BAB57017.1 Staphylococcus aureus subsp. aureus Mu50     similar to anti-repressor
dbj|BAF77733.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.855 Staphylococcus aureus subsp. aureus Mu50 FIG   Phage antirepressor protein
fig|158878.14.peg.880 Staphylococcus aureus subsp. aureus Mu50 FIG   Phage antirepressor protein
fig|418127.4.peg.794 Staphylococcus aureus subsp. aureus Mu3 FIG   Phage antirepressor protein
fig|585891.3.peg.879 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Phage antirepressor protein
gi|14246624 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to anti-repressor
gi|156721316 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979181 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0850
gi|15923845 Staphylococcus aureus subsp. aureus Mu50 NCBI   anti-repressor
gi|255005643 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_04210
img|637099368 Staphylococcus aureus aureus Mu50 IMG   similar to anti-repressor
img|640903591 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sav:SAV0855   KEGG   anti-repressor
kegg|saw:SAHV_0850 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371379.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   anti-repressor
ref|YP_001441440.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0850
ref|ZP_05144244.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_04210
tr|A7X043 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q932B6 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to anti-repressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|418127.6.peg.863 Phage integrase


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search