The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|411471.5.peg.3176: Subdoligranulum variabile DSM 15176

This feature in The SEED Viewer

NCBI Taxonomy Id: 411471

Current Assignment: FIG00515953: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG704769 from base 333225 to 344925 (11701 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3170 333225 334154 930 +       2: 1 2   Chromosome (plasmid) partitioning protein ParB  
rna.56 334723 334647 77 - 492         tRNA-Ile-GAT  
rna.57 334802 334727 76 - 3         tRNA-Ala-TGC  
3171 335462 335602 141 + 659         hypothetical protein  
3172 336380 336754 375 + 777         hypothetical protein  
3173 336789 337535 747 + 34         hypothetical protein  
3174 337549 337869 321 + 13         hypothetical protein  
3175 337882 338301 420 + 12         hypothetical protein  
3176 338388 338888 501 + 86       FIG00515953: hypothetical protein  
3177 338885 340714 1830 + -4 4     TrsK-like protein  
3178 340933 341151 219 + 218 4     Maff2 family protein # long form  
3179 341221 342090 870 + 69 6     Tn5252, Orf23  
3180 342492 342361 132 - 270         hypothetical protein  
3181 342457 344925 2469 + -36         TrsE-like protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|411471.5.peg.3176 FIG00515953: hypothetical protein
MQEEVENRTLTLVVSGTKFTGRLLKAAISKYMAHCKEKKLQKQRSRDAPVTPHGKQTVKQ
LIGQNQGISNIEITDPSIKEFEKIARKYGVDYAVKKDRSSSPPKYLIFFKGRDADALTAA
FTEYTSKKVKKAEKTERPSVLAKLSQFKEMVKNAVVDRTKRKELER

MD5 = 104984eb49a3c5ae4321151a16263275


  DNA Sequence

>fig|411471.5.peg.3176 FIG00515953: hypothetical protein
atgcaggaagaagtggaaaacaggactttaacgctggttgtcagtggaacaaagttcacc
ggcaggctgctcaaagccgccatcagcaagtacatggcccactgcaaggaaaagaagctg
caaaagcaaagaagccgtgacgctcctgtgacaccccacggcaaacagaccgtcaagcag
ctcattggtcagaatcaggggatctccaatatcgagatcacagacccttccatcaaggaa
tttgagaagatcgcccggaaatatggtgtggattatgcggtgaagaaagaccgcagcagc
tccccgcccaagtacctgatctttttcaaaggccgtgacgccgatgcgctgaccgctgca
tttaccgagtacaccagcaaaaaggtcaagaaggccgagaaaacggaacgcccgtctgtg
ctggcaaaactcagtcagttcaaagagatggtcaaaaatgccgtggtggaccgcaccaag
cgaaaggagctggaacgatga


  DNA with Flanking Sequence

>fig|411471.5.peg.3176 FIG00515953: hypothetical protein
gaggaaaagaaagtagcctttaagtgggaatatggggaagaaaccatatcgctgcaactt
gggatgtatgcgaataatcagcggctttatatcggcatgattacccatacagaagatggg
gaggaaccgtttgcagatatgacggtgaaccttccggggtattccctggaccccggagag
gcgtttatttccggtgacatcagcaaggacctgctgcgattcatcaaagagaacaaattg
gggaaggtgcttccctaccaggtgcagtccggttatggaaaatattctgccgttgccttt
gatctggagaagttgaaggcatttgaccccaaaggtgtggctgagtttcggaaagagtgg
aatctgccggataagaagccggtaaagaaaaagagccgcgggatggagcgatgaagaaat
attttctccggaggctggtggttccgccttagaaataaatgcaccacccctgcacatttt
gtggaaaggaggcgatgaaaatgcaggaagaagtggaaaacaggactttaacgctggttg
tcagtggaacaaagttcaccggcaggctgctcaaagccgccatcagcaagtacatggccc
actgcaaggaaaagaagctgcaaaagcaaagaagccgtgacgctcctgtgacaccccacg
gcaaacagaccgtcaagcagctcattggtcagaatcaggggatctccaatatcgagatca
cagacccttccatcaaggaatttgagaagatcgcccggaaatatggtgtggattatgcgg
tgaagaaagaccgcagcagctccccgcccaagtacctgatctttttcaaaggccgtgacg
ccgatgcgctgaccgctgcatttaccgagtacaccagcaaaaaggtcaagaaggccgaga
aaacggaacgcccgtctgtgctggcaaaactcagtcagttcaaagagatggtcaaaaatg
ccgtggtggaccgcaccaagcgaaaggagctggaacgatgaaaaagcagcttgacatcaa
aaagctcgttttgctgaacctgccctatctcctgatggggctgtttgctaccaacttcgg
ggaggcatggcggctggcacagggggcaaatgcttcagagaaattcctttccctgtttgc
tgtcctgcctggagcgctgcaaagtttctggcccagcctgcacccgttggatctgctggt
ggggctgtgctgcggtgctggcctgcgtctggcggtgtatctcaaaagtaaaaacgccaa
gaagtaccgtcatggcatggagtatggttctgcccgttggggaaccagtgaggatattgc
tccctacatcgacccggtgttccagaacaatgtcattctcacaaaaaccgaaagcctgac
catgaacagccgccccaaggacccaaagaccgccagaaacaaaaatgtgctggtgatcgg
cggctccggttccggtaagacccgtttctggctcaaaccaaatctgatgcagatgcacag
t


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|411471.5.peg.2440 Subdoligranulum variabile DSM 15176 FIG   FIG00515953: hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|411471.5.peg.3177 TrsK-like protein
4 fig|411471.5.peg.3178 Maff2 family protein # long form
6 fig|411471.5.peg.3179 Tn5252, Orf23


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search