The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|411471.5.peg.3174: Subdoligranulum variabile DSM 15176

This feature in The SEED Viewer

NCBI Taxonomy Id: 411471

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG704769 from base 332447 to 344925 (12479 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3169 332447 333268 822 +       2: 1 2   Chromosome (plasmid) partitioning protein ParA  
3170 333225 334154 930 + -44     2: 1 2   Chromosome (plasmid) partitioning protein ParB  
rna.56 334723 334647 77 - 492         tRNA-Ile-GAT  
rna.57 334802 334727 76 - 3         tRNA-Ala-TGC  
3171 335462 335602 141 + 659         hypothetical protein  
3172 336380 336754 375 + 777         hypothetical protein  
3173 336789 337535 747 + 34         hypothetical protein  
3174 337549 337869 321 + 13         hypothetical protein  
3175 337882 338301 420 + 12         hypothetical protein  
3176 338388 338888 501 + 86         FIG00515953: hypothetical protein  
3177 338885 340714 1830 + -4         TrsK-like protein  
3178 340933 341151 219 + 218         Maff2 family protein # long form  
3179 341221 342090 870 + 69         Tn5252, Orf23  
3180 342492 342361 132 - 270         hypothetical protein  
3181 342457 344925 2469 + -36         TrsE-like protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|411471.5.peg.3174 hypothetical protein
MGFMQEGKTIGQLMEEMRQKAGAQNYHGHDYMDLQRFAENTRHMIIFDVLTHDSPVGWKG
ERTRLFLSEIGYEKALDSQAKGQIKILSHAKVRNGDLFYDHKEQIR

MD5 = 0d4d23d964e0a40733efa954deb33831


  DNA Sequence

>fig|411471.5.peg.3174 hypothetical protein
gtgggttttatgcaggaaggcaaaacaatcggtcagctgatggaggaaatgcgccagaaa
gccggggcgcagaactatcacggccatgactacatggatctccagcggtttgcggagaac
acccggcacatgattatttttgatgtgctgacgcatgattccccggtgggctggaaagga
gaacgcacccgcctgtttttgtcagagataggctatgaaaaagctctggacagtcaggca
aaggggcagatcaagattctcagccatgcaaaggtcagaaatggagatttgttttatgac
cacaaagaacagatacgatag


  DNA with Flanking Sequence

>fig|411471.5.peg.3174 hypothetical protein
ggcagaacggtttgaacggtgggtgttcgatgaggtcctgcctaccattcgcaagcacgg
ggcctatctcacgaaagagaagctgtgggaggttgccacttccccggaagctctgatgaa
gctctgctcagacttgctggctgagcgtgaagcgaatatttctctgcgtaaggaaaatgc
acagctggagggcaaagccgctttctatgacctgttcatcgacttaaagcacagcaccaa
tctcaggactaccgccaaagagttggatgtcccagagcgccggtttgtccggtttctgat
agaacggcggtttgtgtaccgcacggcatccggcaatgtgctgccttatgccaatgtgaa
aaatgcaggactgttttgcgttaaagactactgcaaccacggtcataccggttcctacac
gctggtcacgccccagggaaagctctactttgcccagctgcgggagatgatcttgctggt
ctcataagaacggaaagaaagtgggttttatgcaggaaggcaaaacaatcggtcagctga
tggaggaaatgcgccagaaagccggggcgcagaactatcacggccatgactacatggatc
tccagcggtttgcggagaacacccggcacatgattatttttgatgtgctgacgcatgatt
ccccggtgggctggaaaggagaacgcacccgcctgtttttgtcagagataggctatgaaa
aagctctggacagtcaggcaaaggggcagatcaagattctcagccatgcaaaggtcagaa
atggagatttgttttatgaccacaaagaacagatacgataggaggaatccgatatgaatg
aggaaaagaaagtagcctttaagtgggaatatggggaagaaaccatatcgctgcaacttg
ggatgtatgcgaataatcagcggctttatatcggcatgattacccatacagaagatgggg
aggaaccgtttgcagatatgacggtgaaccttccggggtattccctggaccccggagagg
cgtttatttccggtgacatcagcaaggacctgctgcgattcatcaaagagaacaaattgg
ggaaggtgcttccctaccaggtgcagtccggttatggaaaatattctgccgttgcctttg
atctggagaagttgaaggcatttgaccccaaaggtgtggctgagtttcggaaagagtgga
atctgccggataagaagccggtaaagaaaaagagccgcgggatggagcgatgaagaaata
ttttctccggaggctggtggttccgccttagaaataaatgcaccacccctgcacattttg
t


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|411471.5.peg.2438 Subdoligranulum variabile DSM 15176 FIG   hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search