The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|411471.5.peg.2541: Subdoligranulum variabile DSM 15176

This feature in The SEED Viewer

NCBI Taxonomy Id: 411471

Current Assignment: TrsE-like protein
Translate Function Assignments



Context on contig NZ_GG657715 from base 769396 to 783583 (14188 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2535 769396 770139 744 +           Phage antirepressor protein  
2536 770226 770726 501 + 86         FIG00515953: hypothetical protein  
2537 770723 772552 1830 + -4         TrsK-like protein  
2538 772767 772985 219 + 214         FIG00529559: hypothetical protein  
2539 773056 773925 870 + 70         Tn5252, Orf23  
2540 773948 774364 417 + 22         FIG00516512: hypothetical protein  
2541 774468 776741 2274 + 103         TrsE-like protein  
2542 776738 777118 381 + -4         hypothetical protein  
2543 777111 778844 1734 + -8         NLP/P60 family protein  
2544 779029 778910 120 - 65         hypothetical protein  
2545 779033 779587 555 + 3         hypothetical protein  
2546 779594 779848 255 + 6         hypothetical protein  
2547 779838 780620 783 + -11         Bacteriocin-like protein  
2548 780814 781500 687 + 193         hypothetical protein  
2549 781490 783583 2094 + -11     1: 1   DNA topoisomerase III (EC 5.99.1.2)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|411471.5.peg.2541 TrsE-like protein
MWPDGICKVADGRYTKTIQFQDINYQLSQNEDKTAIFEGWCDFLNYFDSSIRFQLSFLNL
AASQETFANSIAIPAQGDDFDPIRVEYTQMLQNQLARGNNGLIKTKYLTFSIEADSIRSA
KPRLERIETDVLNNFKRLGVAAEVLDGKARLAQLHAIFHMDEQAPFQFEWDWLAPSGLST
KDFIAPSGFEFRTGKQFRMGKKYGAVSFVQILAPELNDRMLADFLDMESSLIVNLHIQSV
DQVKAIKTVKRKITDLDRSKIEEQKKAVRAGYDMDIIPSDLATYGAEAKKLLQDLQSRNE
RMFLVTFLVLNTADNPRQLGNNIFQASSIAQKYNCQLTRLDFQQEEGLMSSLPLGLNQVE
IQRGLTTSSTAIFVPFTTQELFQNGKEALYYGINALSNNLIMVDRKLLKNPNGLILGTPG
SGKSFSAKREIANCFLLTSDDVIICDPEAEYAPLVERLHGQVIKISPTSTNYINPMDLNL
DYSDDESPLSLKSDFILSLCELIVGGKDGLQPVQKTIIDRCVRLVYQDYLNDPRPENMPI
LEDLYDLLRAQDEKEAQYIATALEIYVTGSLNVFNHRSNVDINNRIVCYDIKELGKQLKK
IGMLVVQDQVWNRVTINRAARKSTRYYIDEMHLLLKEEQTAAYTVEIWKRFRKWGGIPTG
ITQNVKDLLSSREVENIFENSDFVYMLNQAGGDRQILARQLGISPHQLSYVTHSGEGEGL
LFYGSTILPFVDHFPKNTELYRIMTTKPQEMKEADGR

MD5 = b1e5b8cc3b43e121bcc55b697e84268a


  DNA Sequence

>fig|411471.5.peg.2541 TrsE-like protein
atgtggccggacggcatctgcaaggtggcggatggccgctacaccaagaccatccagttc
caggacatcaactaccagctcagccagaacgaggacaagaccgccatcttcgagggatgg
tgtgattttctcaactattttgacagctccatccgtttccagctgtcctttttgaacctg
gcggcgtcccaggagaccttcgccaacagcatcgccattccggcccagggggatgatttt
gaccccatccgggtggagtacacgcagatgctgcaaaatcagctggcgcggggcaacaac
ggcctcatcaagaccaagtacctgaccttttccatcgaggccgacagcatccgctccgcc
aagccccgtctggagcgcatcgagaccgatgtgctgaacaactttaagcggttgggcgtg
gccgccgaggttctggacggcaaagcccggctggcccagcttcacgccatcttccacatg
gacgagcaggcgcccttccagttcgagtgggactggctggctcccagcggcctttccacc
aaggactttatcgcgccgtccggcttcgagttccgtaccggcaagcagttccgcatggga
aagaagtacggggccgtcagcttcgtgcagattctggccccggagctgaatgaccgtatg
ctggcggactttctcgatatggaaagttccctcattgtgaatctgcacatccagtcggtg
gatcaggtgaaggccatcaagacggtaaagcggaaaatcaccgacctggaccgcagcaag
atcgaggaacagaaaaaggccgtccgcgccgggtatgacatggacatcatcccctccgac
cttgccacctacggggccgaggccaagaagctgttgcaggacctgcaaagccgcaacgag
cggatgttcctggtgacgttcctggtgctgaacacggcggacaatccccgccagctgggc
aacaacatcttccaggccagctccatcgcgcaaaagtacaactgccagctgacccggctg
gacttccagcaggaggaaggcttgatgtcctctctgccgctggggctgaaccaggtggaa
attcagcgggggctgactaccagctccaccgccatcttcgtgccgttcacgacccaggag
ctttttcagaacggcaaggaggcgctgtactacggcatcaacgccctgtccaacaacctc
atcatggtggaccgcaaactgctgaaaaaccccaacggcctgattctgggtacgccgggc
agcggcaaatccttcagcgccaagcgcgagatcgccaactgcttcctgctgacttcggat
gatgtcatcatctgcgacccggaggccgagtacgcgccgctggtggagcgcctgcacggg
caggtcatcaagatttcgcccacctccaccaactacatcaacccgatggacctgaacctg
gactattcggacgatgaaagcccgctgtcgctgaaatccgactttatcctgtcgctgtgt
gaactgattgtgggcggcaaggacggattgcagccggtgcagaaaaccatcattgaccgc
tgtgtgcggctggtgtatcaggactacctcaacgatccgcgcccggagaatatgcccatt
ctggaggatttgtacgacctgctgcgggcgcaggatgagaaagaggcgcagtacatcgca
acggcgctggaaatctacgtcaccggctccctcaacgtgttcaaccaccgcagcaacgtg
gacatcaacaaccgcattgtctgctacgacatcaaggagctgggcaagcagctgaaaaag
atcgggatgctggtggtccaggaccaggtgtggaaccgcgtcaccatcaaccgggccgcc
cgcaagtctacccgctactacatcgacgagatgcacctgctcttgaaagaggaacagact
gccgcctacacggtggagatttggaagcggttccgaaagtggggcggcattcccacgggc
atcacccagaacgtgaaggacctgctttcttcccgcgaggtggagaacatctttgaaaac
tccgacttcgtgtatatgctcaaccaggcgggcggtgaccggcagattttggcccggcag
ctgggtatttccccgcaccagctgtcctatgtgacccactccggcgagggcgaggggctg
ctgttctacggctccaccatcctgccctttgtggaccacttccccaagaataccgaactg
tatcgcattatgacgaccaaaccccaggaaatgaaggaggctgatggacgatga


  DNA with Flanking Sequence

>fig|411471.5.peg.2541 TrsE-like protein
caaagacctgacgaaagtcaaaaccaaggtcgcattcaacttaaccaaaaggcagcttgt
ctgcttcggctgcggggcgctcatcggcgtgccgcttttctttttgctccgggggcctgc
tggcaacagcgtggcggccatgtgcatgatgctcgtcatgctgcccttcttcatgctggc
gatgtatgaaaaacacggccagcccctggaaaagatcatcggcaacatcctcaaggtggc
cgtcatccggcccaagcagcgcccctaccgcaccaacaacttctatgccgtgttggagcg
gcaggcaaatctcgacaaggaggtgtatgacattgttcgcggcaaagacaaagcggcagg
ccgaaccggcagagccgcagaccaaaccccggcgtaagctgacccgcgccgaacgcaaac
agatcgaggcagcgattgcccgcgctaaccgcacggacaaaaaagagctgtccgcccagg
acagcatcccctatgagcggatgtggccggacggcatctgcaaggtggcggatggccgct
acaccaagaccatccagttccaggacatcaactaccagctcagccagaacgaggacaaga
ccgccatcttcgagggatggtgtgattttctcaactattttgacagctccatccgtttcc
agctgtcctttttgaacctggcggcgtcccaggagaccttcgccaacagcatcgccattc
cggcccagggggatgattttgaccccatccgggtggagtacacgcagatgctgcaaaatc
agctggcgcggggcaacaacggcctcatcaagaccaagtacctgaccttttccatcgagg
ccgacagcatccgctccgccaagccccgtctggagcgcatcgagaccgatgtgctgaaca
actttaagcggttgggcgtggccgccgaggttctggacggcaaagcccggctggcccagc
ttcacgccatcttccacatggacgagcaggcgcccttccagttcgagtgggactggctgg
ctcccagcggcctttccaccaaggactttatcgcgccgtccggcttcgagttccgtaccg
gcaagcagttccgcatgggaaagaagtacggggccgtcagcttcgtgcagattctggccc
cggagctgaatgaccgtatgctggcggactttctcgatatggaaagttccctcattgtga
atctgcacatccagtcggtggatcaggtgaaggccatcaagacggtaaagcggaaaatca
ccgacctggaccgcagcaagatcgaggaacagaaaaaggccgtccgcgccgggtatgaca
tggacatcatcccctccgaccttgccacctacggggccgaggccaagaagctgttgcagg
acctgcaaagccgcaacgagcggatgttcctggtgacgttcctggtgctgaacacggcgg
acaatccccgccagctgggcaacaacatcttccaggccagctccatcgcgcaaaagtaca
actgccagctgacccggctggacttccagcaggaggaaggcttgatgtcctctctgccgc
tggggctgaaccaggtggaaattcagcgggggctgactaccagctccaccgccatcttcg
tgccgttcacgacccaggagctttttcagaacggcaaggaggcgctgtactacggcatca
acgccctgtccaacaacctcatcatggtggaccgcaaactgctgaaaaaccccaacggcc
tgattctgggtacgccgggcagcggcaaatccttcagcgccaagcgcgagatcgccaact
gcttcctgctgacttcggatgatgtcatcatctgcgacccggaggccgagtacgcgccgc
tggtggagcgcctgcacgggcaggtcatcaagatttcgcccacctccaccaactacatca
acccgatggacctgaacctggactattcggacgatgaaagcccgctgtcgctgaaatccg
actttatcctgtcgctgtgtgaactgattgtgggcggcaaggacggattgcagccggtgc
agaaaaccatcattgaccgctgtgtgcggctggtgtatcaggactacctcaacgatccgc
gcccggagaatatgcccattctggaggatttgtacgacctgctgcgggcgcaggatgaga
aagaggcgcagtacatcgcaacggcgctggaaatctacgtcaccggctccctcaacgtgt
tcaaccaccgcagcaacgtggacatcaacaaccgcattgtctgctacgacatcaaggagc
tgggcaagcagctgaaaaagatcgggatgctggtggtccaggaccaggtgtggaaccgcg
tcaccatcaaccgggccgcccgcaagtctacccgctactacatcgacgagatgcacctgc
tcttgaaagaggaacagactgccgcctacacggtggagatttggaagcggttccgaaagt
ggggcggcattcccacgggcatcacccagaacgtgaaggacctgctttcttcccgcgagg
tggagaacatctttgaaaactccgacttcgtgtatatgctcaaccaggcgggcggtgacc
ggcagattttggcccggcagctgggtatttccccgcaccagctgtcctatgtgacccact
ccggcgagggcgaggggctgctgttctacggctccaccatcctgccctttgtggaccact
tccccaagaataccgaactgtatcgcattatgacgaccaaaccccaggaaatgaaggagg
ctgatggacgatgaaacccgaaattctgcataacgaccacatgatgtttctggaccgggc
gctggaaacccagcgcaccgcgctcctgacggcgatggcggacgccgtttccgagtgccg
cacggcggcggatcaggccgctgaactgaccgagaccggcgagaccggcctgctgcggct
ggtggagattctgtgcgccgccaaggtccagcgcgggcaggccggtgagactgtgctgga
gggcaccgaggtccagattttggccgacgtagtggcccagctctacgcctgcctgaccga
gtgccgcttcgtgggtccgctggggctggcggcctatgcggagctttccagcatggcggc
ctccctcatgctgggggaatggtttgattaaggaaccgcgcctgcgcttcacggaggaag
aacgggcggacccggcgctggaaaagcccatccgcaaggcggagaaggccgccgtcaaag
cggacaaggcgcaggcaaaaatcccgaaaaagca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|411471.5.peg.3277 Subdoligranulum variabile DSM 15176 FIG   TrsE-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search