The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|411471.5.peg.2538: Subdoligranulum variabile DSM 15176

This feature in The SEED Viewer

NCBI Taxonomy Id: 411471

Current Assignment: FIG00529559: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG657715 from base 766969 to 778844 (11876 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2531 766969 767904 936 +       2: 1 2   Chromosome (plasmid) partitioning protein ParB  
2532 767919 768197 279 + 14         hypothetical protein  
2533 768288 768413 126 + 90         hypothetical protein  
2534 768478 769356 879 + 64         hypothetical protein  
2535 769396 770139 744 + 39         Phage antirepressor protein  
2536 770226 770726 501 + 86         FIG00515953: hypothetical protein  
2537 770723 772552 1830 + -4         TrsK-like protein  
2538 772767 772985 219 + 214         FIG00529559: hypothetical protein  
2539 773056 773925 870 + 70         Tn5252, Orf23  
2540 773948 774364 417 + 22         FIG00516512: hypothetical protein  
2541 774468 776741 2274 + 103         TrsE-like protein  
2542 776738 777118 381 + -4         hypothetical protein  
2543 777111 778844 1734 + -8         NLP/P60 family protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|411471.5.peg.2538 FIG00529559: hypothetical protein
MEFFNQAITVLQTLVIALGAGLGVWGVINLLEGYGNDNPGAKSQGMKQLMAGAGVAIVGM
VLVPLLSGLFTV

MD5 = d90dcfdfd72e869e9a3c0d12cb72a8e2


  DNA Sequence

>fig|411471.5.peg.2538 FIG00529559: hypothetical protein
atggaatttttcaatcaggcaatcaccgttctccagaccctcgttatcgccctcggtgcc
ggtctcggcgtgtggggcgtcatcaacctgctggaaggttacggcaacgacaaccccggt
gccaaaagccagggcatgaaacagctcatggccggcgcgggtgtcgctatcgtcggcatg
gtgctggtgcccctgctgtccggcctgttcaccgtctga


  DNA with Flanking Sequence

>fig|411471.5.peg.2538 FIG00529559: hypothetical protein
gcgggagacttcccactcgctcaactatcaaaaattggggaaggcgctgatgagccaaga
cgagctggccgtcatggacggcagcaagtgcattttgcagctgcgcggtgtgcggccgtt
cctctcggacaagtacgacatcacccagcaccccaactacaagtacaccgccgacgccga
cccgaagaacgcctttgatattgaaggctatctcaaggcccggctgaagctcaaacccaa
ccaggtctgcgacgtgtatgagatcgacgccgcagccaacgaatgatgctccgctgtgaa
aggaggggtcctatctatccgccacaaccgccccgctggggccatcggcgtacaaagcgg
acgatctctatcaaaataatgaaaaaggaggaaggccggaatcagccagcccggaaatcg
ggcggcgattgtccggcttttgtatgcctatgaaccataactaatcaatctttttcaaat
gattccggccaactttatttatggaatttttcaatcaggcaatcaccgttctccagaccc
tcgttatcgccctcggtgccggtctcggcgtgtggggcgtcatcaacctgctggaaggtt
acggcaacgacaaccccggtgccaaaagccagggcatgaaacagctcatggccggcgcgg
gtgtcgctatcgtcggcatggtgctggtgcccctgctgtccggcctgttcaccgtctgat
cgttacccgctgaaatcctcgccccctcccgctgtgcacgggaggggcagaaaggaggtt
tgacaccgtatggatttcttattggatgccctgaccaactggctgaaggaaatgctggtg
ggcggcatcatgggaaacttaacggggatgttcgacagcgtgaaccagcaggtcgcggat
atatccgtacaggtgggccagaccccgcagggctggaacggcgacattttcaacatgatc
cagagcctctccaactccatcatggtgccgattgcaggcgtgatcctggccatcgtgatg
acgctggagctgatccagatgattaccgaccgcaacaacctgcatgatgtggacacctgg
atgatcttcaaatgggtgttcaaatccgccgccgtgattttgctggtcaccaacacctgg
aacctcgtcatgggcgtgttcgacatggcccaaagcgtggtggcccaagcgtccggcatc
atcggctcggacgcttcca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|411471.5.peg.3274 Subdoligranulum variabile DSM 15176 FIG   FIG00529559: hypothetical protein
gb|EEG44219.1 Subdoligranulum variabile DSM 15176     hypothetical protein SUBVAR_02996
gi|225033973 Subdoligranulum variabile DSM 15176 NCBI   hypothetical protein SUBVAR_02996
gi|225566643 Subdoligranulum variabile DSM 15176 NCBI   hypothetical protein SUBVAR_02996
ref|ZP_03776450.1 Subdoligranulum variabile DSM 15176 RefSeq   hypothetical protein SUBVAR_02996
tr|C0CFI7 Subdoligranulum variabile DSM 15176 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search