The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|411471.5.peg.2536: Subdoligranulum variabile DSM 15176

This feature in The SEED Viewer

NCBI Taxonomy Id: 411471

Current Assignment: FIG00515953: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG657715 from base 765278 to 776741 (11464 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
rna.48 765278 765362 85 +       1: 3   tRNA-Leu-CAA  
2529 765552 765400 153 - 37         hypothetical protein  
2530 766386 767012 627 + 833     2: 1 2   Chromosome (plasmid) partitioning protein ParA  
2531 766969 767904 936 + -44     2: 1 2   Chromosome (plasmid) partitioning protein ParB  
2532 767919 768197 279 + 14         hypothetical protein  
2533 768288 768413 126 + 90         hypothetical protein  
2534 768478 769356 879 + 64         hypothetical protein  
2535 769396 770139 744 + 39         Phage antirepressor protein  
2536 770226 770726 501 + 86         FIG00515953: hypothetical protein  
2537 770723 772552 1830 + -4         TrsK-like protein  
2538 772767 772985 219 + 214         FIG00529559: hypothetical protein  
2539 773056 773925 870 + 70         Tn5252, Orf23  
2540 773948 774364 417 + 22         FIG00516512: hypothetical protein  
2541 774468 776741 2274 + 103         TrsE-like protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|411471.5.peg.2536 FIG00515953: hypothetical protein
MQEEVENRTLTLIVSGTKFTGRLFKAAISKYMAHRREKKLEKQRSRDSPVTPKGKQTVKQ
LIGQNQGVSNIEINDPSIRDFERIARKYGVDYAVKKDRSALPPKYLIFFKARDADALTAA
FSEYTQKKVKKADRSERPSVLAKLAQFKELLKNTVVDRSRRKELER

MD5 = d7ad5f7d305e3a964d9e6b22f0d753a1


  DNA Sequence

>fig|411471.5.peg.2536 FIG00515953: hypothetical protein
atgcaggaggaagtggaaaacaggactttgacgctgatcgtcagcgggacaaagttcacc
gggcggctgttcaaggccgccatatccaagtacatggcccaccgcagggagaaaaagctg
gaaaagcagcgcagccgggattcccccgttacccccaagggcaagcagacggtgaagcag
ctcatcgggcagaaccagggcgtctccaacatcgagatcaacgacccgtccatccgtgat
tttgagcgcatcgcccgcaagtacggcgtggactatgcggtaaaaaaggaccgcagcgcc
ttgccgcccaagtacctgatcttcttcaaagcccgtgacgccgacgccctgacggcggca
ttctcggagtacacccagaagaaggtcaagaaggccgaccgcagcgagcgcccgtccgtg
ctggcgaagctggctcagttcaaggagctgctcaaaaataccgtggtggaccgcagccgc
cggaaggagctggaacgatga


  DNA with Flanking Sequence

>fig|411471.5.peg.2536 FIG00515953: hypothetical protein
agggaaaaactgtgggaggtcgccacctcgccggaggcgctgctgaagctctgctccgac
ctgctggccgagcgcgagaagaacgcggcgctgcaagcggacaacgcccggctgcaaggc
aaggccgtctactacgacctgtttatcgacctgcggcacagcaccaacctgcgcaccacc
gccaaggagttggaggtgccggagcggcgcttcgtccgtttcctgctggaacgccggtac
gtttaccgcgccccctccggctgtgtgctgccctacgccaagagcgccaacgaggggctg
ttctgtgtgaaggatttttgccgcaacggccacactggctcctacacgctggtgacgccc
aagggcaagctgcactttgcagaactgcggtcgctgatcctggtgacggtatgacaggcc
ggtatctgctgcggcggctggtggtcccgccttagattcaagaccacccactgcataacc
gacgaagggaggcgagaaaaatgcaggaggaagtggaaaacaggactttgacgctgatcg
tcagcgggacaaagttcaccgggcggctgttcaaggccgccatatccaagtacatggccc
accgcagggagaaaaagctggaaaagcagcgcagccgggattcccccgttacccccaagg
gcaagcagacggtgaagcagctcatcgggcagaaccagggcgtctccaacatcgagatca
acgacccgtccatccgtgattttgagcgcatcgcccgcaagtacggcgtggactatgcgg
taaaaaaggaccgcagcgccttgccgcccaagtacctgatcttcttcaaagcccgtgacg
ccgacgccctgacggcggcattctcggagtacacccagaagaaggtcaagaaggccgacc
gcagcgagcgcccgtccgtgctggcgaagctggctcagttcaaggagctgctcaaaaata
ccgtggtggaccgcagccgccggaaggagctggaacgatgaagcagctgaatgtgaaaaa
gctgatgctgctgaacctgccctatatcctgctgggcctgtttgccaccaacctggggga
agcctggcggctggcgaccggcgcggatgcgtccgccaagatgctctcgttcttctccac
cctgccggtggcgctggcaagctggtggcccagcctgcacccactggatttgctggtggg
gctttgctgcggcgctggcctgcggctggcggtgtacctgaaaggcaagaacgccaagaa
gtaccgccacaacgtggagtatggttcggcccgttggggcacccatgacgatattgcccc
ctacatcgacccggtgttccagaataacgtcattctgacccaaaccgagcggcttaccat
gtccagccgccccaagaaccccaagtatgcccgcaacaagaacgtgctggtcatcggcgg
ttccggcagcggcaagacccgcttctggttgaagcccaatctgatgcagatgcacagctc
c


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|411471.5.peg.3272 Subdoligranulum variabile DSM 15176 FIG   FIG00515953: hypothetical protein
gb|EEG44217.1 Subdoligranulum variabile DSM 15176     hypothetical protein SUBVAR_02994
gi|225033971 Subdoligranulum variabile DSM 15176 NCBI   hypothetical protein SUBVAR_02994
gi|225566641 Subdoligranulum variabile DSM 15176 NCBI   hypothetical protein SUBVAR_02994
ref|ZP_03776448.1 Subdoligranulum variabile DSM 15176 RefSeq   hypothetical protein SUBVAR_02994
tr|C0CFI5 Subdoligranulum variabile DSM 15176 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search