The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|411471.5.peg.2530: Subdoligranulum variabile DSM 15176

This feature in The SEED Viewer

NCBI Taxonomy Id: 411471

Current Assignment: Chromosome (plasmid) partitioning protein ParA
Translate Function Assignments



Context on contig NZ_GG657715 from base 759692 to 772552 (12861 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2525 762562 759692 2871 -       2: 7 13   Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)  
2526 763588 762677 912 - 114         hypothetical protein  
2527 764243 763581 663 - -8         probable phosphoglycolate phosphatase  
2528 764862 764260 603 - 16     11: 5 11 10 4 3 15 8 16 12 9 6   Substrate-specific component QueT (COG4708) of predicted queuosine-regulated ECF transporter  
rna.48 765278 765362 85 + 415     1: 14   tRNA-Leu-CAA  
2529 765552 765400 153 - 37         hypothetical protein  
2530 766386 767012 627 + 833     2: 1 2   Chromosome (plasmid) partitioning protein ParA  
2531 766969 767904 936 + -44     2: 1 2   Chromosome (plasmid) partitioning protein ParB  
2532 767919 768197 279 + 14         hypothetical protein  
2533 768288 768413 126 + 90         hypothetical protein  
2534 768478 769356 879 + 64         hypothetical protein  
2535 769396 770139 744 + 39         Phage antirepressor protein  
2536 770226 770726 501 + 86         FIG00515953: hypothetical protein  
2537 770723 772552 1830 + -4         TrsK-like protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Two_cell_division_clusters_relating_to_chromosome_partitioning RossO Chromosome (plasmid) partitioning protein ParA
Bacterial_Cytoskeleton OlgaZ Chromosome (plasmid) partitioning protein ParA


  Protein Sequence

>fig|411471.5.peg.2530 Chromosome (plasmid) partitioning protein ParA
MGRILMDEPIKPGEGILHHPEGVDLMPADIQLSGMEVSLVNAMSRETILRQYLDTVKGQY
SHILIDCQPSLGMLTVNALAAANRIIVPVQAEYLPAKGLEQLLSTINKVKRQLNPKLQID
GILLTMVDNRTNFAKEIAALLRETYGSKIKVFGTEIPHSVRAKEISAEGKSIFAHDPGGK
VAEAYKNLTREVIKLEKQREKSRAGLSR

MD5 = 0245553d40dceeaf5b884b1b0e2d99c4


  DNA Sequence

>fig|411471.5.peg.2530 Chromosome (plasmid) partitioning protein ParA
atgggccgtattctcatggacgagccgatcaaacccggcgagggcatcctgcaccacccg
gagggcgtggacctgatgcctgccgacatccagctctccggcatggaggtatccctagtg
aatgccatgagccgcgagacgattctgcggcagtatctggacacggtgaagggacagtat
tcccatatcctcatcgactgccaaccctccctgggaatgctcacggtcaacgcgctggcc
gccgccaacaggatcatagtccccgtccaagcggagtatctgcccgccaagggcctggaa
cagctgctgtccaccatcaacaaggtcaagcggcagttaaatcccaagctccagatcgac
ggtattctgctgacgatggtggacaaccgcaccaactttgccaaagagatcgccgccctg
ctgcgggagacctacggcagcaaaatcaaggtgttcggcaccgagattccccactcggtt
cgagccaaggagatcagcgccgagggcaagagcatcttcgcacatgaccccggcggcaag
gtggcggaagcctataaaaatctgacgcgggaggtgataaaacttgaaaagcagcgcgaa
aaaagtagagctggcctcagtcgatga


  DNA with Flanking Sequence

>fig|411471.5.peg.2530 Chromosome (plasmid) partitioning protein ParA
gtgaagtcattgaacccacaaatcatcgccgttgccaaccagaagggcggcgtcggcaaa
acgactacctgcgccaacttaggcatcgggctggcgcaggccggaaagaaggtgctgctg
gtggatgctgacccgcaggccagcctcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncaacccgcagccggacaagctgc
cctttaccctgtccgatgcgatgggccgtattctcatggacgagccgatcaaacccggcg
agggcatcctgcaccacccggagggcgtggacctgatgcctgccgacatccagctctccg
gcatggaggtatccctagtgaatgccatgagccgcgagacgattctgcggcagtatctgg
acacggtgaagggacagtattcccatatcctcatcgactgccaaccctccctgggaatgc
tcacggtcaacgcgctggccgccgccaacaggatcatagtccccgtccaagcggagtatc
tgcccgccaagggcctggaacagctgctgtccaccatcaacaaggtcaagcggcagttaa
atcccaagctccagatcgacggtattctgctgacgatggtggacaaccgcaccaactttg
ccaaagagatcgccgccctgctgcgggagacctacggcagcaaaatcaaggtgttcggca
ccgagattccccactcggttcgagccaaggagatcagcgccgagggcaagagcatcttcg
cacatgaccccggcggcaaggtggcggaagcctataaaaatctgacgcgggaggtgataa
aacttgaaaagcagcgcgaaaaaagtagagctggcctcagtcgatgacctgttttccacc
gaggaaagccgcgccgacgcccagcgtgaaaaagtcatggaaattcccttgtcggagctg
cacccattcaaggatcacccctttaaggtcaaggacgatgaggccatgatggagaccgcc
gacagcatccggcagtacggcgtactggtcccggccattgcccgcccggaccctaatggc
ggctatgagctggttgccgggcaccggcggcaccgagctagcgagctggcgggtaaagaa
accatgccggtgattgtccgcgacctggacgatgaccaggccaccatcatcatggttgac
agcaatttgcagcgggaaagcctgctccccagtgaaagggcttttgcctacaagatgaag
ctggaagctatgaagcgacaagctggcagaccgtccaaagaaaattgttcccaagttggg
aacgattttgggaagaagtcgagcgaggtattggctgaacaggtcggccagagtaaaaac
cagattt


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search