The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|411471.5.peg.2529: Subdoligranulum variabile DSM 15176

This feature in The SEED Viewer

NCBI Taxonomy Id: 411471

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG657715 from base 759692 to 770726 (11035 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2525 762562 759692 2871 -       2: 7 13   Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)  
2526 763588 762677 912 - 114         hypothetical protein  
2527 764243 763581 663 - -8         probable phosphoglycolate phosphatase  
2528 764862 764260 603 - 16     11: 5 11 10 4 3 15 8 16 12 9 6   Substrate-specific component QueT (COG4708) of predicted queuosine-regulated ECF transporter  
rna.48 765278 765362 85 + 415     1: 14   tRNA-Leu-CAA  
2529 765552 765400 153 - 37         hypothetical protein  
2530 766386 767012 627 + 833     2: 1 2   Chromosome (plasmid) partitioning protein ParA  
2531 766969 767904 936 + -44     2: 1 2   Chromosome (plasmid) partitioning protein ParB  
2532 767919 768197 279 + 14         hypothetical protein  
2533 768288 768413 126 + 90         hypothetical protein  
2534 768478 769356 879 + 64         hypothetical protein  
2535 769396 770139 744 + 39         Phage antirepressor protein  
2536 770226 770726 501 + 86         FIG00515953: hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|411471.5.peg.2529 hypothetical protein
MKEIQEWLGHSDIGTTSNIYTHLDYSSKVSSANAILAFYPENTGVQTIGQ

MD5 = f18d2e04cd118e5b6e28b62ca1fc89bc


  DNA Sequence

>fig|411471.5.peg.2529 hypothetical protein
ttgaaggaaatccaggaatggctggggcacagtgatattggaacgacttccaacatctac
acccatctggattacagcagcaaggtttcttctgcgaatgcgatcctggcgttctaccca
gagaacacgggagtacagaccattgggcaatag


  DNA with Flanking Sequence

>fig|411471.5.peg.2529 hypothetical protein
nnnnnnnnnnnnnnnnnnnngaggctggcctgcgggtcagcatccaccagcagcaccttc
tttccggcctgcgccagcccgatgcctaagttggcgcaggtagtcgttttgccgacgccg
cccttctggttggcaacggcgatgatttgtgggttcaatgacttcacctcatttctgatt
gggtgttgtcatgtgcctgcataacagccctggaaacaacaaaagccgccacttaaaaca
agtgacggcttcgcttaaatccaatattctgttgtgtttggaatcaaaaggttttgagtt
cctttctgctattcatttgtcgttaatgaaacacctcctgcaattcgacttatttcagta
tgatttttcggtttggaaaaggatgaaaaaatcagactgaaaacctcaaaacccttgatc
ctacggggcttttccggtttgtcgtaattataccgtaagggcacagctgcgccagcctcc
tttacgcaaatggcgtcagcttgaaggaaatccaggaatggctggggcacagtgatattg
gaacgacttccaacatctacacccatctggattacagcagcaaggtttcttctgcgaatg
cgatcctggcgttctacccagagaacacgggagtacagaccattgggcaatagaaaagcc
ctgaaccgtgaagctcagggctgaaaattctggtgccggtggtgggactcgaacccacac
ggatttctccacacgattttgagtcgcggtcgtctgccaattccgacacaccggcattta
tattttaatttcccttgtgtcccgcacatctcagattttggagggatgtgcgggagggat
attaaaaccaaatgaaaatatgaagttgtgaaagcgccgatttatcaagggttttgccag
ggcacccaacattctacgaagtagattttgagtccgtctcgtctgccaattccaacacac
cggcttgtaactcttgaattataaacggtttgcgtgggaaagtcaagcccgtttgccctt
ttacgtcaatttttgcgtcaaaccctcttgcaaccgttatcttgctttgttataatagca
ttttgttgagcaacttaggattttaggctccgccgcagcttccgcggcgcaaaccggtgt
caggctggcggtc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0006310       P:DNA recombination
GO:0015074       P:DNA integration
fig|411471.5.peg.3265 Subdoligranulum variabile DSM 15176 FIG   hypothetical protein
gb|EEG44380.1 Subdoligranulum variabile DSM 15176     hypothetical protein SUBVAR_02985
gi|225034134 Subdoligranulum variabile DSM 15176 NCBI   hypothetical protein SUBVAR_02985
gi|225566249 Subdoligranulum variabile DSM 15176 NCBI   hypothetical protein SUBVAR_02985
ref|ZP_03776439.1 Subdoligranulum variabile DSM 15176 RefSeq   hypothetical protein SUBVAR_02985
tr|C0CFH6 Subdoligranulum variabile DSM 15176 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search