The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|411470.6.peg.667: Ruminococcus gnavus ATCC 29149

This feature in The SEED Viewer

NCBI Taxonomy Id: 411470

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_AAYG02000006 from base 96153 to 106712 (10560 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
658 96153 96278 126 +           hypothetical protein  
659 96728 96294 435 - 15     3: 8 9 11   Transcriptional regulator, MarR family locus|RUMGNA_00775, protein_id|ZP_02040014.1, gi|154502954, InterPro:IPR000835, InterPro:IPR011991
660 97222 96845 378 - 116         Transposon-encoded protein TnpV locus|RUMGNA_00776, protein_id|ZP_02040015.1, gi|154502955
661 97454 97182 273 - -41         FIG00524930: hypothetical protein locus|RUMGNA_00777, protein_id|ZP_02040016.1, gi|154502956, InterPro:IPR010982
662 97768 97610 159 - 155         Maff2 family protein # short form locus|RUMGNA_00778, protein_id|ZP_02040017.1, gi|154502957
663 99817 97988 1830 - 219         TrsK-like protein locus|RUMGNA_00780, protein_id|ZP_02040019.1, gi|154502959, InterPro:IPR003688
664 100314 99814 501 - -4         FIG00515953: hypothetical protein locus|RUMGNA_00781, protein_id|ZP_02040020.1, gi|154502960
665 100820 100401 420 - 86         hypothetical protein locus|RUMGNA_00782, protein_id|ZP_02040021.1, gi|154502961
666 101144 100842 303 - 21         hypothetical protein locus|RUMGNA_00783, protein_id|ZP_02040022.1, gi|154502962
667 101913 101167 747 - 22         hypothetical protein locus|RUMGNA_00784, protein_id|ZP_02040023.1, gi|154502963, InterPro:IPR003497
668 102724 101948 777 - 34         hypothetical protein locus|RUMGNA_00785, protein_id|ZP_02040024.1, gi|154502964
669 103526 103392 135 - 667         hypothetical protein locus|RUMGNA_00787, protein_id|ZP_02040026.1, gi|154502966, InterPro:IPR013838
670 104609 103674 936 - 147     4: 1 4 2 3   Chromosome (plasmid) partitioning protein ParB locus|RUMGNA_00788, protein_id|ZP_02040027.1, gi|154502967, InterPro:IPR003115, InterPro:IPR004437
671 105387 104566 822 - -44     4: 1 4 2 3   Chromosome (plasmid) partitioning protein ParA locus|RUMGNA_00790, protein_id|ZP_02040029.1, gi|154502969, InterPro:IPR002586
672 105338 105682 345 + -50         hypothetical protein locus|RUMGNA_00789, protein_id|ZP_02040028.1, gi|154502968
673 106257 105865 393 - 182     4: 5 10 7 6   SSU ribosomal protein S9p (S16e) locus|RUMGNA_00791, protein_id|ZP_02040030.1, gi|154502970, InterPro:IPR000754
674 106712 106284 429 - 26     5: 5 13 12 7 6   LSU ribosomal protein L13p (L13Ae) locus|RUMGNA_00792, protein_id|ZP_02040031.1, gi|154502971, InterPro:IPR005822, InterPro:IPR005823

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|411470.6.peg.667 hypothetical protein
MNQMEIFKNPEFGSIRVIEENGKYLFCGTDVAAALGYSNPRDAIIRHCRYVVKRDAPHPQ
SPDRKISMTFIPEGDLYRLIVHSKLPSAEQFERWVFDEVLPTIRKHGAYLTKEKLWEVAT
SPEALMKLCSDLLAEREANISLRKENAQLEGKAAFYDLFIDLKHSTNLRTTAKELDVPER
RFVRFLIERRFVYRTASGNVLPYANVKNAGLFCVKDYCNHGHTGSYTLVTPQGKLYFAQL
REMILLVS

MD5 = 25373128f48d675473318aa6b5bce5fb


  DNA Sequence

>fig|411470.6.peg.667 hypothetical protein
atgaaccagatggaaattttcaaaaacccggagtttggcagtatccgtgtcattgaggaa
aacggcaaatacctgttctgcggaacggatgtggccgctgcgctggggtacagcaatccc
cgcgatgcaattatccgccattgtaggtatgtcgtgaaacgcgacgcacctcacccacaa
agccctgaccgcaaaatcagtatgacttttatcccagaaggcgatttgtaccgcctgatc
gttcatagcaaattgccatcggcagagcagtttgaacggtgggtattcgatgaggtcctg
cctaccattcgcaagcacggagcctatctcacaaaagagaagctgtgggaggtagccact
tccccggaagctctgatgaagctctgctcagacctgttggctgagcgtgaagcaaatatt
tctctgcgtaaggaaaatgcacagctggagggcaaagccgctttctatgacctgttcatc
gacttaaagcacagcaccaatctcaggactaccgccaaagagttggatgtcccggagcgc
cggtttgttcggtttctgatagaacggcggtttgtgtaccgcacggcatccggcaatgtg
ctgccttatgccaatgtgaaaaatgcagggctgttttgcgtcaaagactactgcaaccac
ggccataccggttcctacacgctggtcacgccccagggcaagctctattttgcccagctg
cgggagatgatcttgctggtctcataa


  DNA with Flanking Sequence

>fig|411470.6.peg.667 hypothetical protein
aaaatcaattacttatggatcaagtaccgattccattcccttccgggaaacagcggcggc
aagaccgccggaacggaaaggaagggatgcgatgtctgtcacagagatagaaaattatcg
ggagttgattttggagaatatcgagtatgactgcttgaagcagcgttatcctctctacct
ggatgacctgaatgagatcgtagagctgttggtagaaaccgtctgtgccaaacgaaagac
cacccggatttctggggcagacttccctcacgagatcgtgcgttcccgttttttgaagtt
ggatagctcccacatcgagtttgtcatggactgtctgcaaaagaacaccacccaggtacg
caacatgaagcagtacctgcttgcggtgctgttcaatgcgcctaccaccatgaacaatca
cttcacttcattggtcaaccacgatatgcacgcaggcggctggtaaaggctgccttttat
catgccaaaggaggcacgacatgaaccagatggaaattttcaaaaacccggagtttggca
gtatccgtgtcattgaggaaaacggcaaatacctgttctgcggaacggatgtggccgctg
cgctggggtacagcaatccccgcgatgcaattatccgccattgtaggtatgtcgtgaaac
gcgacgcacctcacccacaaagccctgaccgcaaaatcagtatgacttttatcccagaag
gcgatttgtaccgcctgatcgttcatagcaaattgccatcggcagagcagtttgaacggt
gggtattcgatgaggtcctgcctaccattcgcaagcacggagcctatctcacaaaagaga
agctgtgggaggtagccacttccccggaagctctgatgaagctctgctcagacctgttgg
ctgagcgtgaagcaaatatttctctgcgtaaggaaaatgcacagctggagggcaaagccg
ctttctatgacctgttcatcgacttaaagcacagcaccaatctcaggactaccgccaaag
agttggatgtcccggagcgccggtttgttcggtttctgatagaacggcggtttgtgtacc
gcacggcatccggcaatgtgctgccttatgccaatgtgaaaaatgcagggctgttttgcg
tcaaagactactgcaaccacggccataccggttcctacacgctggtcacgccccagggca
agctctattttgcccagctgcgggagatgatcttgctggtctcataagaacagaaaggaa
gtgggttttatgcaggaaggcaaaacaatcggtcagctgatggaggaaatgcgccagaaa
gccggggcgcagaactaccacggccatgactacatggatctccagcgatttgcggagaac
acgcggcacatgattatttttgatgtgctgacgcatgactccccggtgggctggaaagga
gaacgcacccgcctgtttttgtcagatataggctatgaaaaagctctggacagtcaggca
aaggggcagatcaagattctcagccatgcaaaggtcagaaatggagatttgttttatgac
cacaaaaattagatacgataggaggaatctgatatgaatgaggaaaagaaagtacccttc
aagtgggaatatggggaagaaaccatatcgctgcaacttgggatgtatgcgaataatcag
cggctctatatcggcatgattacccatacagaagatggagcagagccgtttgcagatatg
acggtga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
gb|EDN78922.1 Ruminococcus gnavus ATCC 29149     hypothetical protein RUMGNA_00784
gi|153796502 Ruminococcus gnavus ATCC 29149 NCBI   hypothetical protein RUMGNA_00784
gi|154502963 Ruminococcus gnavus ATCC 29149 NCBI   hypothetical protein RUMGNA_00784
img|641052134 Ruminococcus gnavus ATCC 29149 IMG   hypothetical protein
ref|ZP_02040023.1 Ruminococcus gnavus ATCC 29149 RefSeq   hypothetical protein RUMGNA_00784
tr|A7AZR1 Ruminococcus gnavus ATCC 29149 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search