The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|405440.3.peg.1074: Xylella fastidiosa M12

This feature in The SEED Viewer

NCBI Taxonomy Id: 405440

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig CP000941 from base 1239865 to 1251700 (11836 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1066 1239865 1240269 405 +         ff FIG01219616: hypothetical protein Xfasm12_1169, ACA12120.1, gi|167965110
1067 1240266 1240727 462 + -4         hypothetical protein Xfasm12_1170, ACA12121.1, gi|167965111
1068 1240724 1241131 408 + -4       ff FIG01217517: hypothetical protein Xfasm12_1171, ACA12122.1, gi|167965112
1069 1241128 1241319 192 + -4       ff FIG01218187: hypothetical protein Xfasm12_1172, ACA12123.1, gi|167965113
1070 1241920 1241351 570 - 31         DNA helicase, phage-associated Xfasm12_1173, ACA12124.1, gi|167965114
1071 1242005 1242409 405 + 84       ff Phage protein Xfasm12_1174, ACA12125.1, gi|167965115
1072 1242689 1242411 279 - 1       cwn
ff
Phage protein Xfasm12_1175, ACA12126.1, gi|167965116
1073 1244866 1242686 2181 - -4       cwh phage-related DNA polymerase Xfasm12_1176, ACA12127.1, gi|167965117
1074 1246130 1244868 1263 - 1       ff Phage antirepressor protein Xfasm12_1177, ACA12128.1, gi|167965118
1075 1246687 1246121 567 - -10       cwn
ff
Phage protein Xfasm12_1178, ACA12129.1, gi|167965119
1076 1247964 1246687 1278 - -1       cwn
ff
Phage protein Xfasm12_1179, ACA12130.1, gi|167965120
1077 1248458 1247961 498 - -4         FIG01217753: hypothetical protein Xfasm12_1180, ACA12131.1, gi|167965121
1078 1248642 1248448 195 - -11       ff FIG01217231: hypothetical protein Xfasm12_1181, ACA12132.1, gi|167965122
1079 1248784 1248674 111 - 31         conserved hypothetical protein Xfasm12_1182, ACA12133.1, gi|167965123
1080 1248819 1249706 888 + 34         DNA helicase, phage-associated Xfasm12_1183, ACA12134.1, gi|167965124
1081 1249703 1249948 246 + -4         hypothetical protein Xfasm12_1184, ACA12135.1, gi|167965125
1082 1249948 1250967 1020 + -1         Mobile element protein Xfasm12_1185, ACA12136.1, gi|167965126
1083 1251074 1251700 627 + 106       ff putative outer membrane protein Xfasm12_1186, ACA12137.1, gi|167965127

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|405440.3.peg.1074 Phage antirepressor protein
MGVNRIHTTGSTRNGRAEKRAPSTGLHRKDNIMNAPSEFTLQFESHAVRVQLDEHERRWF
NANDICAALELLNPRAALAQHVGAENVSKRKTIDAVGWTKHANYLNESGVYALLIGSTKE
AAKRFRQWLTDEALPAAQKAGHHIIPLHSAIDSAPSVPSPFQHTENHTMNAITPFQFESK
DVRIQLDEANAPWFNANDVCAVLEFGNPHQAIESHVDVEDLQKLEAPTAGGRQRVNHINE
SGLYSLIMGSTKPAAKRFKRWVTSEVLPTLRKTGTYSTPGALPTLPGPTQDRIAALLLIG
QYISTVPGMKPGIAAAATLACIKSNTNLTTEELRRALPALQEPLCLLNATQLGKQLHCSA
KAANQLLASSGFQFRNERDAWELTEAGRMWGEAIPYSRNGHSSYQILWNPTVLDSLKVAA

MD5 = b9d5820fc61a967445c2ae819d6bd56f


  DNA Sequence

>fig|405440.3.peg.1074 Phage antirepressor protein
gtgggggtgaatcggattcacaccactggcagcacacgaaacggcagggccgagaaacgc
gcgccctccaccggcttgcatcgtaaggacaacatcatgaatgcaccctctgagttcact
ctccagtttgaatcccacgccgtgcgtgtccagctcgacgaacacgagcggcgatggttc
aacgccaatgacatttgcgcggcgttggagttgttaaatccgcgtgctgcacttgctcag
catgtgggtgccgagaatgtatcgaaacgcaaaaccatcgacgccgttgggtggactaag
cacgccaactatttgaacgagtcaggggtgtacgccttgctcatcggcagcaccaaagag
gcggctaaacgctttagacagtggctgaccgatgaagcgctgcccgcagctcaaaaagca
gggcatcacatcatccctctgcacagcgcaatcgacagtgcgccttccgtcccaagcccc
ttccaacacacagagaaccacacaatgaacgcaatcactccattccaattcgaatcaaaa
gatgtgcgtattcagctcgacgaggccaatgcgccttggtttaacgccaatgatgtttgt
gccgttctggagtttggcaatccacatcaagccattgaatcccacgtggatgtagaggat
ctccagaagttggaggcccctacagcaggtggccgtcaacgcgttaaccacatcaacgaa
tctggtttgtactccctgatcatgggcagcacaaaacctgcggccaagcgttttaagcgt
tgggtgacgagcgaagttctgcccaccctgcgtaagacaggcacctactccacaccagga
gcactgcccaccttgcctgggccgacacaggatcgcattgccgcgcttctgttaatcggc
caatacatctccacggtgccagggatgaagccagggattgctgcggcggcaacgctggcc
tgcatcaaaagcaacacgaatttaacaaccgaagagctacgccgtgcattgcctgcgtta
caggaaccgctttgcctgctcaacgccacgcaactaggcaagcagctgcattgctcggcc
aaggcggcgaaccaattattagcctccagtggctttcagttccgtaatgaacgcgacgcg
tgggaattaaccgaagccggtcgcatgtggggtgaagcgattccgtactcacgcaacggg
cacagcagctaccaaattctttggaacccaacggtgcttgactcgctgaaggtagccgcc
tga


  DNA with Flanking Sequence

>fig|405440.3.peg.1074 Phage antirepressor protein
aaagtcaatggtgaaggtgaggccgccttctcggcctgcttcctcatcgaccctgccgac
ccgcaagtcaaagcccttaaccaggcgattgacaagatggccaatgacaaatggggcgtt
aaggcggcgggccagcttaaacagatgcgtatgggcgacagagtcgccttgcatgatggc
gacctgaaagccagctatgacgggtttgcagggcacctatacgtctctgcgcgtaacaag
tcccgggtgctggtgatcgaccgtgaccggaccccgctcaccgcgcaggacggcaggccg
tatgccggatgttacgtcaacgccaacatagaactctgggcgcaggataacaactacggc
aagcggattaacgcctcgctgggtggcgtgcagttcctgcgtgatggcgaggcgttcgct
ggaggcggtgtggccagcgtggaggacttcgaggacctgagcgccattgctgaggtgatg
gatgttgaaggagccatgtcgtgggggtgaatcggattcacaccactggcagcacacgaa
acggcagggccgagaaacgcgcgccctccaccggcttgcatcgtaaggacaacatcatga
atgcaccctctgagttcactctccagtttgaatcccacgccgtgcgtgtccagctcgacg
aacacgagcggcgatggttcaacgccaatgacatttgcgcggcgttggagttgttaaatc
cgcgtgctgcacttgctcagcatgtgggtgccgagaatgtatcgaaacgcaaaaccatcg
acgccgttgggtggactaagcacgccaactatttgaacgagtcaggggtgtacgccttgc
tcatcggcagcaccaaagaggcggctaaacgctttagacagtggctgaccgatgaagcgc
tgcccgcagctcaaaaagcagggcatcacatcatccctctgcacagcgcaatcgacagtg
cgccttccgtcccaagccccttccaacacacagagaaccacacaatgaacgcaatcactc
cattccaattcgaatcaaaagatgtgcgtattcagctcgacgaggccaatgcgccttggt
ttaacgccaatgatgtttgtgccgttctggagtttggcaatccacatcaagccattgaat
cccacgtggatgtagaggatctccagaagttggaggcccctacagcaggtggccgtcaac
gcgttaaccacatcaacgaatctggtttgtactccctgatcatgggcagcacaaaacctg
cggccaagcgttttaagcgttgggtgacgagcgaagttctgcccaccctgcgtaagacag
gcacctactccacaccaggagcactgcccaccttgcctgggccgacacaggatcgcattg
ccgcgcttctgttaatcggccaatacatctccacggtgccagggatgaagccagggattg
ctgcggcggcaacgctggcctgcatcaaaagcaacacgaatttaacaaccgaagagctac
gccgtgcattgcctgcgttacaggaaccgctttgcctgctcaacgccacgcaactaggca
agcagctgcattgctcggccaaggcggcgaaccaattattagcctccagtggctttcagt
tccgtaatgaacgcgacgcgtgggaattaaccgaagccggtcgcatgtggggtgaagcga
ttccgtactcacgcaacgggcacagcagctaccaaattctttggaacccaacggtgcttg
actcgctgaaggtagccgcctgagatggccaccgcgcagccacccgcacccatcctatgg
ggggatctagagacgtactcccccgtaccgattgcgcatggcgtgcatgcgtatgctgag
caagccgagctattgctgtttgcttacgcgatcggcaacggtccggtgcaggtgtgggac
tgcacggccacggcaacgatgcctgaggagctgtcggctgcgttgcacaaccccgcggtg
ctgctgtacttccacaactcccattttgaccggaccgtgctacgccattgcggcatcgac
atccccttggagcgctggcgcgattcaatggcccaggccttggcccattcgctgcctggg
gcgctaggcacgttatgcgagctgctgcgcgttcctgtggagcaagccaaggccaaggac
ggcaaacggctcgttgcactgttttgcaaaccgcgccctacccactgcacgttgcgccgt
gccacacgtgacacccatccgaccgactgggcacagtttgtgg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|405440.5.peg.1387 Xylella fastidiosa M12 FIG   Phage antirepressor protein
gb|ACA12128.1 Xylella fastidiosa M12     conserved hypothetical protein
gi|167965118 Xylella fastidiosa M12 NCBI   conserved hypothetical protein
gi|170730325 Xylella fastidiosa M12 NCBI   hypothetical protein Xfasm12_1177
img|641649196 Xylella fastidiosa M12 IMG   hypothetical protein
kegg|xfm:Xfasm12_1177 Xylella fastidiosa M12 KEGG   hypothetical protein
ref|YP_001775758.1 Xylella fastidiosa M12 RefSeq   hypothetical protein Xfasm12_1177
tr|B0U2P9 Xylella fastidiosa (strain M12) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code ff


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search