The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|40324.1.peg.1948: Stenotrophomonas maltophilia K279a

This feature in The SEED Viewer

NCBI Taxonomy Id: 40324

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig malt085c11.p1k from base 560132 to 571472 (11341 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1942 562432 560132 2301 -         cwn
ff
DNA primase/helicase, phage-associated  
1943 562683 562429 255 - -4         FIG01112959: hypothetical protein  
1944 563417 562680 738 - -4       cwh
ff
Bucepa02001210 protein family (probably prophage associated)  
1945 563904 563428 477 - 10         FIG01111859: hypothetical protein  
1946 564625 563984 642 - 79       cwn
ff
FIG00973834: hypothetical protein  
1947 565581 564631 951 - 5       cwn
ff
Methyl-accepting chemotaxis protein  
1948 566246 565485 762 - -97       ff Phage antirepressor protein  
1949 566728 566252 477 - 5         hypothetical protein  
1950 567003 566740 264 - 11         FIG01113239: hypothetical protein  
1951 568027 567098 930 - 94         hypothetical protein  
1952 569465 568041 1425 - 13         hypothetical protein  
1953 570375 569563 813 - 97         hypothetical protein  
1954 570654 570376 279 - 0         transcriptional regulator, XRE family  
1955 571017 571472 456 + 362       cwn Putative bacteriophage-related protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|40324.1.peg.1948 Phage antirepressor protein
MSAIIPFQFEAHAVRIQVDGAGLPWFNASDVCNALEMGNPSQAIKSHVDGDDLQKLEVID
NLGRTQRANHVNESGLYALILGSTKDAAKRFKRWLTSEVLPAIRKTGSYAAPSALAALPA
PTHDRVSAILLIGEAVAKVPGVKPGIAAAATLTCIQENTGITTEVLRRALPSANEPICAL
NATQLGKLLNRSAKATNQMLAAGGFQFRNDRDEWELTEAGEAWAEAMPYSRNGHSGYQIL
WNPAVADELKEAA

MD5 = fce5016f3f6d2eecebe319f2101c2ab9


  DNA Sequence

>fig|40324.1.peg.1948 Phage antirepressor protein
atgagcgcaatcattcccttccagttcgaagcacacgccgtgcgcatccaggtcgatggt
gctggcctgccgtggttcaacgccagcgacgtctgcaatgccttggagatgggcaatccg
tctcaggcgatcaaatcccacgtcgatggtgatgatctccagaaattggaggtcatcgac
aacctcggccgcacgcagcgcgccaaccatgtcaacgagtctggcctctacgccctgatc
ctcggcagcaccaaggatgccgccaagcgtttcaagcgttggctcaccagtgaagtgctg
cccgcgatccgcaagaccggcagctacgccgcccccagtgcgctggcggccttgcccgcg
ccgacccacgaccgcgtgtccgcaatcctgctgatcggcgaggctgtagcgaaggtgccg
ggcgtgaagccgggcatcgccgcagcggcaacgctcacatgcattcaggagaacaccggc
atcaccaccgaggtgctgcgccgtgcgctgccgtcggccaatgagccgatctgcgcgctc
aatgccacccagctcggcaagctgctgaaccgttcggccaaggccaccaaccagatgctg
gcggcaggcggcttccagtttcgcaacgaccgcgacgaatgggaactgaccgaggctggt
gaagcatgggccgaagccatgccgtactcgcgcaacggccacagcggctaccagatcctc
tggaacccggcggttgccgacgagctgaaggaggccgcgtga


  DNA with Flanking Sequence

>fig|40324.1.peg.1948 Phage antirepressor protein
ccagtgagggagatggccatgaacgatctaaccatcttccccgccgacatcgccgagatg
tccgtcagccagctggctgcgctgccgcccgagcagaaggcggaaatcgacaagaacctc
gacgcagccattgactggctcaagaaggcacgcaccaagttcgatgccgcgctggatgcg
gcctacggagagcaggcccgcgccgcactgcgtgaatccggtcgcgatttcggcaccgcc
cacatcagcgatggcccgctacatctgaagttcgagctgcccaagaaggtcagctggaac
cagcagcagttgaccgagatcgccgaacgcatcgtcgcctcgggcgagaaggtcgagggc
tacctcgacatcaagttgtccgtctccgaatcccgctacacgaactggcctccggcgctg
caacagcagttcgccgccgcccgcaccgtggattgcggcaagccgtctttcaccccttcc
ctcgattcggagtaatcgccatgagcgcaatcattcccttccagttcgaagcacacgccg
tgcgcatccaggtcgatggtgctggcctgccgtggttcaacgccagcgacgtctgcaatg
ccttggagatgggcaatccgtctcaggcgatcaaatcccacgtcgatggtgatgatctcc
agaaattggaggtcatcgacaacctcggccgcacgcagcgcgccaaccatgtcaacgagt
ctggcctctacgccctgatcctcggcagcaccaaggatgccgccaagcgtttcaagcgtt
ggctcaccagtgaagtgctgcccgcgatccgcaagaccggcagctacgccgcccccagtg
cgctggcggccttgcccgcgccgacccacgaccgcgtgtccgcaatcctgctgatcggcg
aggctgtagcgaaggtgccgggcgtgaagccgggcatcgccgcagcggcaacgctcacat
gcattcaggagaacaccggcatcaccaccgaggtgctgcgccgtgcgctgccgtcggcca
atgagccgatctgcgcgctcaatgccacccagctcggcaagctgctgaaccgttcggcca
aggccaccaaccagatgctggcggcaggcggcttccagtttcgcaacgaccgcgacgaat
gggaactgaccgaggctggtgaagcatgggccgaagccatgccgtactcgcgcaacggcc
acagcggctaccagatcctctggaacccggcggttgccgacgagctgaaggaggccgcgt
gatgagccttcccatcatctccgcgcagcagcgcatggccgagcgcaagggcgtcaagct
cctgatgcttggcaagtccggcatcggcaagaccacccgactcaaagatctcgaccccgc
caccaccttgttcctcgacatcgaggccggtgatctggccgtggccgattggccgggcga
caccatccgtccggcgtcctggcccgagagccgcgacttcttcgtgttcctcgcgggccc
ggacaagtcgctgccgccggagtcggcgttctcgcaggcgcatttcgctcacgtcgtcga
gaagttcggtgacccggcgcagctgggccgctaccagaccttctttctcgactcgatcac
ccagctgtcgcgccagtgtttcgcgtggtgcaagacgcagccgggtgccgtcagcgaccg
ctccggcaagccggatctgcgtgcggcctacggcctgctcggccaggaaatgatcggcgc
gctgacccacctgcagcacgca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
emb|CAQ45416.1 Stenotrophomonas maltophilia K279a EMBL   putative phage-related protein
fig|522373.3.peg.1817 Stenotrophomonas maltophilia K279a FIG   Phage antirepressor protein
gi|190011796 Stenotrophomonas maltophilia K279a NCBI   putative phage-related protein
gi|190573874 Stenotrophomonas maltophilia K279a NCBI   putative phage-related protein
img|642693021 Stenotrophomonas maltophilia K279a IMG   putative phage-related protein
kegg|sml:Smlt1892 Stenotrophomonas maltophilia K279a KEGG   putative phage-related protein
ref|YP_001971719.1 Stenotrophomonas maltophilia K279a RefSeq   putative phage-related protein
tr|B2FM48 Stenotrophomonas maltophilia (strain K279a) TrEMBL   Putative phage-related protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33416 972.100;1-57
CDD::42474 978.700;14-101
evidence_code ff
isoelectric_point 6.36
molecular_weight 27095
PFAM::PF02498 967.690;13-101
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search