The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|396513.4.peg.476: Staphylococcus carnosus subsp. carnosus TM300

This feature in The SEED Viewer

NCBI Taxonomy Id: 396513

Current Assignment: Phage essential recombination function protein, Erf
Translate Function Assignments



Context on contig NC_012121 from base 475670 to 486228 (10559 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
466 475852 475670 183 -       1: 1   hypothetical protein locus|Sca_0464, protein_id|YP_002633563.1, gi|224475957, geneID|7551723
467 476658 476194 465 - 341         Phage phi 11 orf35 protein homolog locus|Sca_0465, protein_id|YP_002633564.1, gi|224475958, geneID|7550069
468 476997 476674 324 - 15         Phage repressor protein cI locus|Sca_0466, protein_id|YP_002633565.1, gi|224475959, geneID|7550070
469 477436 478203 768 + 438         Phage antirepressor protein locus|Sca_0467, protein_id|YP_002633566.1, gi|224475960, geneID|7550071
470 478218 478364 147 + 14     1: 1   hypothetical protein locus|Sca_0468, protein_id|YP_002633567.1, gi|224475961, geneID|7550072
471 478581 478357 225 - -8     1: 1   hypothetical protein locus|Sca_0469, protein_id|YP_002633568.1, gi|224475962, geneID|7550073
472 479524 479252 273 - 670     1: 1   hypothetical protein locus|Sca_0470, protein_id|YP_002633569.1, gi|224475963, geneID|7550074
473 479588 479824 237 + 63         Phage phi 11 orf10 protein homolog locus|Sca_0471, protein_id|YP_002633570.1, gi|224475964, geneID|7550075
474 479905 480042 138 + 80     1: 1   Phage protein  
475 480500 480628 129 + 457         Phage phi-ETA orf16 protein homolog locus|Sca_0473, protein_id|YP_002633572.1, gi|224475966, geneID|7550077
476 480585 481256 672 + -44         Phage essential recombination function protein, Erf locus|Sca_0474, protein_id|YP_002633573.1, gi|224475967, geneID|7550078
477 481256 481687 432 + -1     3: 2 4 3   Phage ssDNA binding protein gene_name|ssb, locus|Sca_0475, protein_id|YP_002633574.1, gi|224475968, geneID|7550079
478 481699 482250 552 + 11         Phage HNH endonuclease locus|Sca_0476, protein_id|YP_002633575.1, gi|224475969, geneID|7552147
479 482251 482925 675 + 0         Phage phi 11 orf14 protein homolog locus|Sca_0477, protein_id|YP_002633576.1, gi|224475970, geneID|7550080
480 482922 483683 762 + -4         Phage replication initiation protein locus|Sca_0478, protein_id|YP_002633577.1, gi|224475971, geneID|7550081
481 483684 484469 786 + 0     1: 5   Phage DNA helicase loader locus|Sca_0479, protein_id|YP_002633578.1, gi|224475972, geneID|7550082
482 484635 485042 408 + 165         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) locus|Sca_0480, protein_id|YP_002633579.1, gi|224475973, geneID|7550083
483 485051 485215 165 + 8     1: 1   hypothetical protein locus|Sca_0481, protein_id|YP_002633580.1, gi|224475974, geneID|7550084
484 485425 485751 327 + 209     1: 1   Phage phi 11 orf21 protein homolog locus|Sca_0482, protein_id|YP_002633581.1, gi|224475975, geneID|7550085
485 485752 486228 477 + 0         Phage protein locus|Sca_0483, protein_id|YP_002633582.1, gi|224475976, geneID|7550086

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|396513.4.peg.476 Phage essential recombination function protein, Erf
MTQEMNLFQKIADVKANIDGFTKDTKGYNYSYVSGSQVLHRIRNKMIENNLLLVPKTSEE
NYKQIDVTRFNKKAGREITTSEFIVEMKLTYVWINADKPEEQFEVTFYAVGQQDDVSKAH
GTALTYAERYFLMKFFNIPTDEDDADAKEKREQYTKPDAKAIGTLKEEMLKFSELMQSVG
KQVSVDDVQQKLGINDVQNLSNSQITVCIKKLDNWSKQAKENE

MD5 = 67b932ca1f1a9df5b801c82d341084d9


  DNA Sequence

>fig|396513.4.peg.476 Phage essential recombination function protein, Erf
atgacacaggaaatgaacctattccagaaaatagcagatgttaaagctaatatagatgga
ttcactaaagatactaaaggctacaactactcatatgttagtggttcgcaagtattacac
agaattagaaataagatgattgaaaacaatttattacttgtaccaaaaacatcagaagaa
aattacaaacaaattgatgtgacaagatttaataaaaaagctggtcgtgagattacaaca
tcagaatttatcgttgaaatgaaattgacttatgtgtggatcaatgcagacaaaccagaa
gaacagttcgaagtaacattttatgcagtaggacaacaagatgacgtttctaaagcacat
ggtactgcactaacttacgcagaaagatacttcttaatgaaattcttcaatattccaact
gatgaagatgatgcagatgcaaaagaaaagcgcgagcaatataccaaaccagatgctaaa
gcgattgggacattaaaagaagaaatgttgaaattcagcgaacttatgcagtctgtagga
aaacaagtaagcgttgatgatgtccagcaaaaactaggtatcaacgatgttcaaaattta
agtaatagtcaaatcactgtgtgcatcaaaaaattagataactggtcaaaacaagcgaag
gagaatgaataa


  DNA with Flanking Sequence

>fig|396513.4.peg.476 Phage essential recombination function protein, Erf
aaattagacactttcatcataacaaatttttacaggaggtactacatgggccttaaaaaa
tatgcacataaatttatcgacatgttagatgagtcggaaatcgaaggatatatagagtat
tcaaaagatccacgacaaactttaatatttgctcactatgacgtcaaatataattcaggt
attcgtttttttattgtaagtagtcaagatactgatgatgaacaactacgtacactcaag
cttattgaaaaactattgagtgacagaaaaaaggtgagttccaatgcctaaacaaacagt
tacctatcttattaagattactgataccaacctatatgttacaaacagacccactgaaca
aaacactacaatcaaatattcaaccagccttagtgacgctagagagttcaacggaatgga
agatgcagcagtagatatgacattccatactgcaataaaaaagacagttacagaaacaac
tgaatatgaggaggtcgcatatgacacaggaaatgaacctattccagaaaatagcagatg
ttaaagctaatatagatggattcactaaagatactaaaggctacaactactcatatgtta
gtggttcgcaagtattacacagaattagaaataagatgattgaaaacaatttattacttg
taccaaaaacatcagaagaaaattacaaacaaattgatgtgacaagatttaataaaaaag
ctggtcgtgagattacaacatcagaatttatcgttgaaatgaaattgacttatgtgtgga
tcaatgcagacaaaccagaagaacagttcgaagtaacattttatgcagtaggacaacaag
atgacgtttctaaagcacatggtactgcactaacttacgcagaaagatacttcttaatga
aattcttcaatattccaactgatgaagatgatgcagatgcaaaagaaaagcgcgagcaat
ataccaaaccagatgctaaagcgattgggacattaaaagaagaaatgttgaaattcagcg
aacttatgcagtctgtaggaaaacaagtaagcgttgatgatgtccagcaaaaactaggta
tcaacgatgttcaaaatttaagtaatagtcaaatcactgtgtgcatcaaaaaattagata
actggtcaaaacaagcgaaggagaatgaataatgattaacagagtcgtattagtaggtcg
tttaacaaaagatccagaattcagaacaaccccgagcggtgtagatgtagcaacattcac
actagcagtcaaccgtaattttaagagtaaaaatggagagcaacaggcggactttatcaa
ctgtgttgtattccgtaaacaagcagaaaacgtcaataattatttgaataaaggcagttt
agcaggtgtcgatggtcgcttacaatcacgcagctatgaaaataaggaaggacaacgtgt
gtttgtaaccgaagtagtagcagatagtgttcaattcttagagccaaagaataacaatca
acaaaacaatcaacctcaacaacaacaagggcaagcaccagcaggcaataacccgtttgg
aaatgctagcgacgatatttcagaatcggaactccctttctaggatgtgattaaatggct
gaaatttggaaagatgtggttggttatgaaggtatctacgaagtaagcaata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
emb|CAL27388.1 Staphylococcus carnosus subsp. carnosus TM300 EMBL   conserved hypothetical phage protein
gi|222420574 Staphylococcus carnosus subsp. carnosus TM300 NCBI   conserved hypothetical phage protein
gi|224475967 Staphylococcus carnosus subsp. carnosus TM300 NCBI   hypothetical protein Sca_0474
kegg|sca:Sca_0474 Staphylococcus carnosus subsp. carnosus TM300 KEGG   hypothetical protein
ref|YP_002633573.1 Staphylococcus carnosus subsp. carnosus TM300 RefSeq   hypothetical protein Sca_0474
tr|B9DJE4 Staphylococcus carnosus (strain TM300) TrEMBL   Conserved hypothetical phage protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search