The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|396513.4.peg.469: Staphylococcus carnosus subsp. carnosus TM300

This feature in The SEED Viewer

NCBI Taxonomy Id: 396513

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_012121 from base 471978 to 483683 (11706 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
463 471978 472448 471 +           Iron-sulfur cluster assembly scaffold protein SufU locus|Sca_0461, protein_id|YP_002633560.1, gi|224475954, geneID|7551485
464 472679 474076 1398 + 230     1: 5   Iron-sulfur cluster assembly protein SufB gene_name|sufB, locus|Sca_0462, protein_id|YP_002633561.1, gi|224475955, geneID|7550068
465 475193 474144 1050 - 67         Phage integrase gene_name|int, locus|Sca_0463, protein_id|YP_002633562.1, gi|224475956, geneID|7552155
466 475852 475670 183 - 476     1: 1   hypothetical protein locus|Sca_0464, protein_id|YP_002633563.1, gi|224475957, geneID|7551723
467 476658 476194 465 - 341         Phage phi 11 orf35 protein homolog locus|Sca_0465, protein_id|YP_002633564.1, gi|224475958, geneID|7550069
468 476997 476674 324 - 15         Phage repressor protein cI locus|Sca_0466, protein_id|YP_002633565.1, gi|224475959, geneID|7550070
469 477436 478203 768 + 438       Phage antirepressor protein locus|Sca_0467, protein_id|YP_002633566.1, gi|224475960, geneID|7550071
470 478218 478364 147 + 14     1: 1   hypothetical protein locus|Sca_0468, protein_id|YP_002633567.1, gi|224475961, geneID|7550072
471 478581 478357 225 - -8     1: 1   hypothetical protein locus|Sca_0469, protein_id|YP_002633568.1, gi|224475962, geneID|7550073
472 479524 479252 273 - 670     1: 1   hypothetical protein locus|Sca_0470, protein_id|YP_002633569.1, gi|224475963, geneID|7550074
473 479588 479824 237 + 63         Phage phi 11 orf10 protein homolog locus|Sca_0471, protein_id|YP_002633570.1, gi|224475964, geneID|7550075
474 479905 480042 138 + 80     1: 1   Phage protein  
475 480500 480628 129 + 457         Phage phi-ETA orf16 protein homolog locus|Sca_0473, protein_id|YP_002633572.1, gi|224475966, geneID|7550077
476 480585 481256 672 + -44         Phage essential recombination function protein, Erf locus|Sca_0474, protein_id|YP_002633573.1, gi|224475967, geneID|7550078
477 481256 481687 432 + -1     3: 2 4 3   Phage ssDNA binding protein gene_name|ssb, locus|Sca_0475, protein_id|YP_002633574.1, gi|224475968, geneID|7550079
478 481699 482250 552 + 11         Phage HNH endonuclease locus|Sca_0476, protein_id|YP_002633575.1, gi|224475969, geneID|7552147
479 482251 482925 675 + 0         Phage phi 11 orf14 protein homolog locus|Sca_0477, protein_id|YP_002633576.1, gi|224475970, geneID|7550080
480 482922 483683 762 + -4 7     Phage replication initiation protein locus|Sca_0478, protein_id|YP_002633577.1, gi|224475971, geneID|7550081

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|396513.4.peg.469 Phage antirepressor protein
MSELQVFNFEELPVRTLIMDDEPYFVGKDVAEVLGYSNTRDALNKHVDEDDKKILTSRNT
TLENLPNRGLTAVNESGLYSLIFSSKLESAKRFKRWVTSKVLPAIRKHGIYATDSVIEQT
IQNPDYIINILTEFKKEREGRLVAEQQVHELKPKATYYDLVLQNKSLLSVSKIAKDYGMS
ARALNKLLHELGVQYKHGDIWLLYAKHQDKGYTHTSTYALDEEHSKVTTKWTQKGRLFIY
DLLKDNNILPTIERG

MD5 = 59707fbf994119ea5c6852606fbf9d02


  DNA Sequence

>fig|396513.4.peg.469 Phage antirepressor protein
atgagcgaattacaagtatttaatttcgaagaattaccagtaaggacattaataatggat
gatgaaccttattttgtaggaaaagatgtggcggaagttttaggatactcaaatacacgt
gatgcgttaaataaacatgttgatgaagatgataagaaaattctaacgtcgcgaaacacg
actttagaaaatttgccaaatcgaggacttacggcagttaatgaatcaggattatacagt
ttaatcttctcatcaaaattagaatcagcaaaacgtttcaaaagatgggtaacatcaaaa
gttttaccagcaattcgcaaacatggaatctacgcaacggatagcgtgattgaacaaacg
atccagaatccggattacatcattaatatcttaactgaatttaaaaaagaacgtgaaggt
cgtttggttgcagaacaacaggtgcatgaactgaaacccaaagctacttattacgatctg
gttctacaaaacaaatctttattatcagtaagcaagattgctaaagattacggaatgagt
gctagagcgctgaacaagttgttgcatgaattaggcgttcaatataaacatggcgatatt
tggttgttatacgcgaaacatcaagataaaggttacacacatacaagcacatatgcatta
gatgaagaacactcaaaagtcactactaaatggacgcaaaagggcagactgttcatttat
gacttgctcaaagacaacaatatcctgcccacaatcgagagaggttaa


  DNA with Flanking Sequence

>fig|396513.4.peg.469 Phage antirepressor protein
gctaaatcaatctgttctaatccatttttctgacgtaagtattttaaatttcggctaaac
attttaatgccccctaaatctatgttttttaaatatctacctatattatacacaaaaacc
tgaaaaagaaaacagaaaaaccgaaaaaaatttcggataaaatgaattatttttcttgac
ttcggaataaccgaaatgatacactatgtacataccaaatcgaaagaggtgagtaaatgt
tcattaaggacgagcatggtaaacctatcgtcttacctttagcgaattggcgtaaaatga
agggtttaactcaaaagagccttgccaaacaggcagaagtgacagaacggactattcaga
attacgaagatgatactaagaatatcagaaacgcaagatattctacaattaagagaatcg
ctgaagcattaggtataggtacggacaatattttttttgattaacgtttcggtttttccg
aaatgagaggagggttataaatgagcgaattacaagtatttaatttcgaagaattaccag
taaggacattaataatggatgatgaaccttattttgtaggaaaagatgtggcggaagttt
taggatactcaaatacacgtgatgcgttaaataaacatgttgatgaagatgataagaaaa
ttctaacgtcgcgaaacacgactttagaaaatttgccaaatcgaggacttacggcagtta
atgaatcaggattatacagtttaatcttctcatcaaaattagaatcagcaaaacgtttca
aaagatgggtaacatcaaaagttttaccagcaattcgcaaacatggaatctacgcaacgg
atagcgtgattgaacaaacgatccagaatccggattacatcattaatatcttaactgaat
ttaaaaaagaacgtgaaggtcgtttggttgcagaacaacaggtgcatgaactgaaaccca
aagctacttattacgatctggttctacaaaacaaatctttattatcagtaagcaagattg
ctaaagattacggaatgagtgctagagcgctgaacaagttgttgcatgaattaggcgttc
aatataaacatggcgatatttggttgttatacgcgaaacatcaagataaaggttacacac
atacaagcacatatgcattagatgaagaacactcaaaagtcactactaaatggacgcaaa
agggcagactgttcatttatgacttgctcaaagacaacaatatcctgcccacaatcgaga
gaggttaaaggaggtgaatggaatgcaagaaaactctttgaaaacgaacccgaacacaat
gtatgaaacgatcaatattttattaaaagaaatacaaaaaaacccaaacccacagttgat
tgaggcaactgcgaatttggtcttagcttacaaagaagtcactagataaattttggtggt
tcagaactagtatttaaatattctatccaaaccactctgtctaaattaacgatgatcttt
tcaggttttttgacttgaagaatacctgcgattgaaggtgtgttttctaaaacttcaact
tcaacattatcgccattatctaagtggagtcttaaaaacatatcctcgtatcgattcaga
aatgttcggatgttatcaatgttcataatatcacctccttaggtgattatatcaaaaccc
acaatcgagcggaattaaaggaggtgagtcaaagtgaacattcaagagcaaaataaaaaa
tctcgatgtagcgatgaccacatcaaga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
emb|CAL27381.1 Staphylococcus carnosus subsp. carnosus TM300 EMBL   putative antirepressor, phage associated
gi|222420567 Staphylococcus carnosus subsp. carnosus TM300 NCBI   putative antirepressor, phage associated
gi|224475960 Staphylococcus carnosus subsp. carnosus TM300 NCBI   putative antirepressor, phage associated
kegg|sca:Sca_0467 Staphylococcus carnosus subsp. carnosus TM300 KEGG   putative antirepressor, phage associated
ref|YP_002633566.1 Staphylococcus carnosus subsp. carnosus TM300 RefSeq   putative antirepressor, phage associated
tr|B9DJG3 Staphylococcus carnosus (strain TM300) TrEMBL   Putative antirepressor, phage associated


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|396513.4.peg.480 Phage replication initiation protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search