The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|393117.11.peg.1633: Listeria monocytogenes FSL J1-194

This feature in The SEED Viewer

NCBI Taxonomy Id: 393117

Current Assignment: DnaD domain protein
Translate Function Assignments



Context on contig NZ_AARJ02000004 from base 45992 to 57273 (11282 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1622 45992 46276 285 +           FIG00774252: hypothetical protein locus|LmonFS_020200008058, protein_id|ZP_05230104.1, gi|254825103
1623 46302 46583 282 + 25         Protein gp41 [Bacteriophage A118] locus|LmonFS_020200008063, protein_id|ZP_05230105.1, gi|254825104
1624 46615 46776 162 + 31         FIG00775553: hypothetical protein locus|LmonFS_020200008068, protein_id|ZP_05230106.1, gi|254825105
1625 47011 46769 243 - -8         Hypothetical protein, Lin0079 homolog [Bacteriophage A118] locus|LmonFS_020200008073, protein_id|ZP_05230107.1, gi|254825106
1626 47075 47854 780 + 63         Phage antirepressor protein / Antirepressor [Bacteriophage A118] locus|LmonFS_020200008078, protein_id|ZP_05230108.1, gi|254825107, CDD:112200
1627 47975 48508 534 + 120         Protein gp43 [Bacteriophage A118] locus|LmonFS_020200008083, protein_id|ZP_05230109.1, gi|254825108
1628 48505 48720 216 + -4         Protein gp44 [Bacteriophage A118] locus|LmonFS_020200008088, protein_id|ZP_05230110.1, gi|254825109
1629 48829 49017 189 + 108         Protein gp45 [Bacteriophage A118] locus|LmonFS_020200008093, protein_id|ZP_05230111.1, gi|254825110, CDD:119173
1630 49250 49438 189 + 232         FIG00776009: hypothetical protein locus|LmonFS_020200008098, protein_id|ZP_05230112.1, gi|254825111
1631 49435 50316 882 + -4         FIG00775957: hypothetical protein locus|LmonFS_020200008103, protein_id|ZP_05230113.1, gi|254825112
1632 50387 51079 693 + 70         Prophage Lp1 protein 19 locus|LmonFS_020200008108, protein_id|ZP_05230114.1, gi|254825113
1633 51100 52020 921 + 20         DnaD domain protein locus|LmonFS_020200008113, protein_id|ZP_05230115.1, gi|254825114, CDD:113268
1634 52017 52598 582 + -4         hypothetical protein locus|LmonFS_020200008118, protein_id|ZP_05230116.1, gi|254825115
1635 52608 52898 291 + 9         FIG00775107: hypothetical protein locus|LmonFS_020200008123, protein_id|ZP_05230117.1, gi|254825116
1636 52898 53878 981 + -1         Modification methylase ScrFIB (EC 2.1.1.37) locus|LmonFS_020200008128, protein_id|ZP_05230118.1, gi|254825117, CDD:73191
1637 53875 54408 534 + -4         Protein gp51 [Bacteriophage A118] locus|LmonFS_020200008133, protein_id|ZP_05230119.1, gi|254825118, CDD:116464
1638 54405 54803 399 + -4         Hypothetical protein, Lmo2313 homolog [Bacteriophage A118] locus|LmonFS_020200008138, protein_id|ZP_05230120.1, gi|254825119, CDD:130732
1639 54807 54980 174 + 3         hypothetical protein locus|LmonFS_020200008143, protein_id|ZP_05230121.1, gi|254825120
1640 54977 55162 186 + -4         FIG00774221: hypothetical protein locus|LmonFS_020200008148, protein_id|ZP_05230122.1, gi|254825121
1641 55159 55449 291 + -4         hypothetical protein locus|LmonFS_020200008153, protein_id|ZP_05230123.1, gi|254825122
1642 55658 55993 336 + 208         hypothetical protein locus|LmonFS_020200008163, protein_id|ZP_05230125.1, gi|254825124
1643 55986 56174 189 + -8         FIG00775799: hypothetical protein locus|LmonFS_020200008168, protein_id|ZP_05230126.1, gi|254825125
1644 56171 56569 399 + -4         Protein gp59 [Bacteriophage A118] locus|LmonFS_020200008173, protein_id|ZP_05230127.1, gi|254825126
1645 56570 56797 228 + 0         hypothetical protein locus|LmonFS_020200008178, protein_id|ZP_05230128.1, gi|254825127
1646 56794 57273 480 + -4         Single-stranded DNA-binding protein (prophage associated) locus|LmonFS_020200008183, protein_id|ZP_05230129.1, gi|254825128, CDD:136030

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|393117.11.peg.1633 DnaD domain protein
MDGYIALHRKIIDSWIWQDPEFYRLWSYCLIKASFKEREIFLGQQIVKLNPGQFVIGREK
LEEAMNIGLKNKRTAVTWWRRLQKLEKAQMLNIKSYNKFSVVTIENWGFYQGGDIENEQQ
NEQQTNNRCTTDVQQTITNNKDNKEKNDNKDNNKRQNKFDEVHLSLANLLFEMIKSNNPE
EKVPDVEKWAHDIRIMIEQDKRDAEKVKNAIIWSQKNDFWCGVIKSPKSLRKNYDQMATQ
RNKPVANKPTFNKYNKPVKEEVLPDWFDKEQKQTKQETSTTESSENLEKKVAEIKAQLAA
RNEAKA

MD5 = ad028ecb695e46e852cf083c706c318f


  DNA Sequence

>fig|393117.11.peg.1633 DnaD domain protein
atggatggttatatagctttacacagaaaaattattgatagctggatatggcaagaccct
gagttttatcggctttggtcatactgccttatcaaagcgtcatttaaagaaagagaaata
tttttaggtcaacaaatagtcaaattaaatccgggtcaatttgtaatcggaagagaaaaa
ttagaagaggcaatgaacataggactgaaaaataaacgaacagcggttacgtggtggcga
cgacttcaaaagttagaaaaagctcaaatgttgaacatcaaatcgtacaacaaattttca
gttgtaaccattgaaaactgggggttttatcaaggtggcgacatagaaaacgaacagcaa
aatgaacaacaaacgaacaacagatgtacaacagatgtacaacagacgatcacaaacaat
aaagataataaagagaagaatgataataaagataataataaacgtcaaaacaagtttgac
gaggttcatttatctttagctaatttattgtttgaaatgattaagtcaaataacccagaa
gaaaaagttccagatgttgaaaaatgggctcatgacatcagaatcatgattgaacaagat
aagcgagatgctgaaaaagttaagaatgcaattatctggtcacagaaaaatgatttctgg
tgcggtgttattaaatcgccgaaatctttaaggaaaaattatgatcagatggcgacgcaa
cgtaataagccagttgcaaacaagcccactttcaacaaatacaacaaaccagtaaaagaa
gaagtattgccagactggttcgacaaagagcagaaacaaacaaaacaagaaacttcaaca
acagaatcaagcgaaaacttagaaaagaaagtcgctgaaattaaagcacagttagcggct
aggaatgaggcgaaggcatga


  DNA with Flanking Sequence

>fig|393117.11.peg.1633 DnaD domain protein
atgattgtaatggatggagaaaaagaagctattgttactgcaaatttattcggaacaact
tggaaagcaaaattagatgtacttaaccatgataaaaaacgtataggcgatttaaagacc
acacaggagctacagaaacgcttttggtcggtcaaatacaacggttgggtatcttttatc
caagcatatgattatgtgcttcaaatggctgtttataaagctatggtggaatgtcaattt
gaaggagactataaaccttatattgtagcagtcacaaaacaaaatccgccagataaagcg
gtaatacaattccatcaaaactggttagatagtgaatatagttttttggaagaaaaaatg
ccacgagttatcgcagttaagaataaagaacttgatgcaataagatgtgaagaatgtgag
tattgccgagcaactaaacaattaaaagatgctatcgatttagaagacttattgaagtag
gataaggcaggggaattgcgatggatggttatatagctttacacagaaaaattattgata
gctggatatggcaagaccctgagttttatcggctttggtcatactgccttatcaaagcgt
catttaaagaaagagaaatatttttaggtcaacaaatagtcaaattaaatccgggtcaat
ttgtaatcggaagagaaaaattagaagaggcaatgaacataggactgaaaaataaacgaa
cagcggttacgtggtggcgacgacttcaaaagttagaaaaagctcaaatgttgaacatca
aatcgtacaacaaattttcagttgtaaccattgaaaactgggggttttatcaaggtggcg
acatagaaaacgaacagcaaaatgaacaacaaacgaacaacagatgtacaacagatgtac
aacagacgatcacaaacaataaagataataaagagaagaatgataataaagataataata
aacgtcaaaacaagtttgacgaggttcatttatctttagctaatttattgtttgaaatga
ttaagtcaaataacccagaagaaaaagttccagatgttgaaaaatgggctcatgacatca
gaatcatgattgaacaagataagcgagatgctgaaaaagttaagaatgcaattatctggt
cacagaaaaatgatttctggtgcggtgttattaaatcgccgaaatctttaaggaaaaatt
atgatcagatggcgacgcaacgtaataagccagttgcaaacaagcccactttcaacaaat
acaacaaaccagtaaaagaagaagtattgccagactggttcgacaaagagcagaaacaaa
caaaacaagaaacttcaacaacagaatcaagcgaaaacttagaaaagaaagtcgctgaaa
ttaaagcacagttagcggctaggaatgaggcgaaggcatgaaaacaatcgcaaatgagta
cgaaactttagaagctattaaaaaagctatggctatgtacgaattaaaaaaagcggataa
agaccacgttgcaactccgcgttatgttgttgaagacatatacagcttgatagatattga
gtcgttcaaaagtctgtggttcccgttcaatcattatgacagcttgttcaaacttagagc
agaagaattaaatcttaaatataaagcgacacatatttttgatgatgtgggaaatgattt
ctttacaacggaaccaccaattgattgtgacttaatgattagtaacccgccgttttcaca
gcaaaacgaaattatagagcgtagttttcagctaatagacgaaaagaaaataaagtcatt
tgctttactattgccgctctcgactctcgaaactgagaaacgagcaagcatattcgaaca
atatagtgacaaattagcgatattgatatttaagaaaagaattaagtttttagggcattc
a


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|393117.3.peg.2532 Listeria monocytogenes FSL J1-194 FIG   DnaD domain protein
gi|254825114 Listeria monocytogenes FSL J1-194 NCBI   phage regulatory protein
img|641752698 Listeria monocytogenes FSL J1-194 IMG   phage protein
ref|ZP_05230115.1 Listeria monocytogenes FSL J1-194 RefSeq   phage regulatory protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search