The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|393117.11.peg.1631: Listeria monocytogenes FSL J1-194

This feature in The SEED Viewer

NCBI Taxonomy Id: 393117

Current Assignment: FIG00775957: hypothetical protein
Translate Function Assignments



Context on contig NZ_AARJ02000004 from base 44094 to 55449 (11356 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1616 44585 44094 492 -           Phage protein locus|LmonFS_020200008028, protein_id|ZP_05230098.1, gi|254825097, CDD:114812
1617 44923 44618 306 - 32         Repressor (CI-like) [Bacteriophage A118] locus|LmonFS_020200008033, protein_id|ZP_05230099.1, gi|254825098, CDD:128803
1618 45049 45291 243 + 125         Repressor (cro-like) [Bacteriophage A118] locus|LmonFS_020200008038, protein_id|ZP_05230100.1, gi|254825099, CDD:128803
1619 45295 45561 267 + 3         Protein gp37 [Bacteriophage A118] locus|LmonFS_020200008043, protein_id|ZP_05230101.1, gi|254825100
1620 45720 45490 231 - -72         Phage protein locus|LmonFS_020200008048, protein_id|ZP_05230102.1, gi|254825101
1621 45786 45980 195 + 65         FIG00774265: hypothetical protein locus|LmonFS_020200008053, protein_id|ZP_05230103.1, gi|254825102
1622 45992 46276 285 + 11         FIG00774252: hypothetical protein locus|LmonFS_020200008058, protein_id|ZP_05230104.1, gi|254825103
1623 46302 46583 282 + 25         Protein gp41 [Bacteriophage A118] locus|LmonFS_020200008063, protein_id|ZP_05230105.1, gi|254825104
1624 46615 46776 162 + 31         FIG00775553: hypothetical protein locus|LmonFS_020200008068, protein_id|ZP_05230106.1, gi|254825105
1625 47011 46769 243 - -8         Hypothetical protein, Lin0079 homolog [Bacteriophage A118] locus|LmonFS_020200008073, protein_id|ZP_05230107.1, gi|254825106
1626 47075 47854 780 + 63         Phage antirepressor protein / Antirepressor [Bacteriophage A118] locus|LmonFS_020200008078, protein_id|ZP_05230108.1, gi|254825107, CDD:112200
1627 47975 48508 534 + 120         Protein gp43 [Bacteriophage A118] locus|LmonFS_020200008083, protein_id|ZP_05230109.1, gi|254825108
1628 48505 48720 216 + -4         Protein gp44 [Bacteriophage A118] locus|LmonFS_020200008088, protein_id|ZP_05230110.1, gi|254825109
1629 48829 49017 189 + 108         Protein gp45 [Bacteriophage A118] locus|LmonFS_020200008093, protein_id|ZP_05230111.1, gi|254825110, CDD:119173
1630 49250 49438 189 + 232         FIG00776009: hypothetical protein locus|LmonFS_020200008098, protein_id|ZP_05230112.1, gi|254825111
1631 49435 50316 882 + -4         FIG00775957: hypothetical protein locus|LmonFS_020200008103, protein_id|ZP_05230113.1, gi|254825112
1632 50387 51079 693 + 70         Prophage Lp1 protein 19 locus|LmonFS_020200008108, protein_id|ZP_05230114.1, gi|254825113
1633 51100 52020 921 + 20         DnaD domain protein locus|LmonFS_020200008113, protein_id|ZP_05230115.1, gi|254825114, CDD:113268
1634 52017 52598 582 + -4         hypothetical protein locus|LmonFS_020200008118, protein_id|ZP_05230116.1, gi|254825115
1635 52608 52898 291 + 9         FIG00775107: hypothetical protein locus|LmonFS_020200008123, protein_id|ZP_05230117.1, gi|254825116
1636 52898 53878 981 + -1         Modification methylase ScrFIB (EC 2.1.1.37) locus|LmonFS_020200008128, protein_id|ZP_05230118.1, gi|254825117, CDD:73191
1637 53875 54408 534 + -4         Protein gp51 [Bacteriophage A118] locus|LmonFS_020200008133, protein_id|ZP_05230119.1, gi|254825118, CDD:116464
1638 54405 54803 399 + -4         Hypothetical protein, Lmo2313 homolog [Bacteriophage A118] locus|LmonFS_020200008138, protein_id|ZP_05230120.1, gi|254825119, CDD:130732
1639 54807 54980 174 + 3         hypothetical protein locus|LmonFS_020200008143, protein_id|ZP_05230121.1, gi|254825120
1640 54977 55162 186 + -4         FIG00774221: hypothetical protein locus|LmonFS_020200008148, protein_id|ZP_05230122.1, gi|254825121
1641 55159 55449 291 + -4         hypothetical protein locus|LmonFS_020200008153, protein_id|ZP_05230123.1, gi|254825122

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|393117.11.peg.1631 FIG00775957: hypothetical protein
MNELGMELSKQQGNGVMAHATASREMEEVKGQIFMAQNFPRNQYQAEIRILEACKRLRLA
ETAIYQYPRGGQKVIGPSIRLAEVLAQNWGNISFGVKELERNDHESTAMAYAWDAETNTR
TEKIFTVPHKRTTKKGTQMVTDERDIYELVANMGSRRLRACLLSVIPGDIVEAAMQQCNE
TLRNGGGEKPLKDRVGAMLTYLKEQFGVTQSQVEKRFGYKTDSFTEYDLVQTKNIINSIK
DGMSKIEDWFDKDLPKKTDSSKSELAKELEPEKEEVKTDDKEQAVETDQGKLL

MD5 = be19be0efbcb6f08b22154fdb2415c23


  DNA Sequence

>fig|393117.11.peg.1631 FIG00775957: hypothetical protein
atgaatgaattaggaatggaattatctaaacagcaggggaacggagttatggctcatgcg
acggcgagtcgtgaaatggaggaagtaaaagggcaaatttttatggcgcaaaatttcccc
cgaaatcaatatcaagcagaaatccgaattttagaagcatgtaaacgacttagattagcg
gaaactgcaatctatcaatatccgcgaggtggtcaaaaagtaattggtccatcaattcgc
ttagcagaagtgttagcgcagaattggggaaatattagctttggtgttaaggaattagaa
agaaacgaccacgagtctacagcaatggcttacgcatgggatgctgaaacaaatactaga
acagaaaaaatattcaccgtgccacacaaacgaacaactaaaaaaggaacgcagatggtt
actgacgaacgagatatatatgagcttgtagctaatatggggtcgcgccgattgagagct
tgcttattgagcgttattcccggagatatagtagaagccgcaatgcaacaatgcaatgaa
acattaagaaatggcggcggagaaaaaccgcttaaagatcgcgttggggctatgttgact
tatttaaaagaacagttcggtgttactcaaagtcaagtcgagaaacgttttgggtataaa
actgactcatttactgaatatgacttagtacagactaaaaacataattaattcgataaag
gacggtatgtcaaaaatagaagattggttcgataaggatttaccaaaaaaaacggactct
tcgaaatctgaactcgcaaaagaattggaaccagaaaaagaagaggtgaaaacagatgac
aaagaacaagccgttgaaactgaccaaggaaaactattatag


  DNA with Flanking Sequence

>fig|393117.11.peg.1631 FIG00775957: hypothetical protein
cattaaacgaaacaggttgcgacaacatgactgactatatagaagagttgaagttaaaag
gttatgaggaggtcacgcgctgatggatgtatttatggtaatgattttcgtgtcgtttat
gtctgtgattgcaggtttttggctgagaggaagtgataaacgtggttgagaatccgatgg
ttgttgatgatctttgggacgatggttttagacattaaaaaagcacgcatagcagtgcgc
gctttaaggatttgagatattaccttaacaaaattatacctcaggtccattaaaaaatca
atggaggtaacatatatgtggtttttaacaacctattcaaatatcaaagtaaaagtgttt
gattttagcgaaagtgaagcggcaaccgaattatttaattatcttcgcttctatcaaagt
aataaagaaggaagtaaagaattcgacgatttaattaagatataccagttgttagttgga
gaagaaggagtggttaacgtatgaatgaattaggaatggaattatctaaacagcagggga
acggagttatggctcatgcgacggcgagtcgtgaaatggaggaagtaaaagggcaaattt
ttatggcgcaaaatttcccccgaaatcaatatcaagcagaaatccgaattttagaagcat
gtaaacgacttagattagcggaaactgcaatctatcaatatccgcgaggtggtcaaaaag
taattggtccatcaattcgcttagcagaagtgttagcgcagaattggggaaatattagct
ttggtgttaaggaattagaaagaaacgaccacgagtctacagcaatggcttacgcatggg
atgctgaaacaaatactagaacagaaaaaatattcaccgtgccacacaaacgaacaacta
aaaaaggaacgcagatggttactgacgaacgagatatatatgagcttgtagctaatatgg
ggtcgcgccgattgagagcttgcttattgagcgttattcccggagatatagtagaagccg
caatgcaacaatgcaatgaaacattaagaaatggcggcggagaaaaaccgcttaaagatc
gcgttggggctatgttgacttatttaaaagaacagttcggtgttactcaaagtcaagtcg
agaaacgttttgggtataaaactgactcatttactgaatatgacttagtacagactaaaa
acataattaattcgataaaggacggtatgtcaaaaatagaagattggttcgataaggatt
taccaaaaaaaacggactcttcgaaatctgaactcgcaaaagaattggaaccagaaaaag
aagaggtgaaaacagatgacaaagaacaagccgttgaaactgaccaaggaaaactattat
agtcaagcagctaatttagattacatgtccgtttcacaattcaaatcttttatggattgc
gaagcacggacaatggcagaacttcataaagaatggtctcgcaacgaatctacagcgctt
ttagttggttcctatacgcatacagcatttgagtcagaacaagcttttaacgactttgtt
tctgagaatgaaaagaagatttataaagcaagaggaacagggaaacgggcagagtttgaa
caagctgatttaatgattgaaacaattaaaaaagacccgctttcaatgattgtaatggat
ggagaaaaagaagctattgttactgcaaatttattcggaacaacttggaaagcaaaatta
gatgtacttaaccatgataaaaaacgtataggcgatttaaagaccacacaggagctacag
aaacgcttttggtcggtcaaatacaacggttgggtatcttttatccaagcatatgattat
gtgcttcaaatggctgtttata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|393130.8.peg.2928 Listeria monocytogenes J0161 FIG   FIG00775957: hypothetical protein
fig|393131.3.peg.2215 Listeria monocytogenes J2818 FIG   FIG00775957: hypothetical protein
fig|393131.7.peg.2884 Listeria monocytogenes J2818 FIG   FIG00775957: hypothetical protein
gi|254825112 Listeria monocytogenes FSL J1-194 NCBI   hypothetical protein LmonFS_08103
gi|254901060 Listeria monocytogenes J0161 NCBI   hypothetical protein LmonJ_14638
gi|254913990 Listeria monocytogenes J2818 NCBI   hypothetical protein LmonJ2_14378
img|640976169 Listeria monocytogenes J2818 IMG   hypothetical protein
ref|ZP_05230113.1 Listeria monocytogenes FSL J1-194 RefSeq   hypothetical protein LmonFS_08103
ref|ZP_05260984.1 Listeria monocytogenes J0161 RefSeq   hypothetical protein LmonJ_14638
ref|ZP_05264002.1 Listeria monocytogenes J2818 RefSeq   hypothetical protein LmonJ2_14378


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search