The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|393117.11.peg.1623: Listeria monocytogenes FSL J1-194

This feature in The SEED Viewer

NCBI Taxonomy Id: 393117

Current Assignment: Protein gp41 [Bacteriophage A118]
Translate Function Assignments



Context on contig NZ_AARJ02000004 from base 40931 to 52020 (11090 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1612 42289 40931 1359 -           Integrase [Bacteriophage A118] locus|LmonFS_020200008008, protein_id|ZP_05230094.1, gi|254825093, CDD:129090
1613 43093 42353 741 - 63         putative superinfection immunity protein locus|LmonFS_020200008013, protein_id|ZP_05230095.1, gi|254825094
1614 43837 43115 723 - 21         Phage A118 gp33 protein homolog locus|LmonFS_020200008018, protein_id|ZP_05230096.1, gi|254825095, CDD:118382
1615 44071 43853 219 - 15         Protein gp34 [Bacteriophage A118] locus|LmonFS_020200008023, protein_id|ZP_05230097.1, gi|254825096
1616 44585 44094 492 - 22         Phage protein locus|LmonFS_020200008028, protein_id|ZP_05230098.1, gi|254825097, CDD:114812
1617 44923 44618 306 - 32         Repressor (CI-like) [Bacteriophage A118] locus|LmonFS_020200008033, protein_id|ZP_05230099.1, gi|254825098, CDD:128803
1618 45049 45291 243 + 125         Repressor (cro-like) [Bacteriophage A118] locus|LmonFS_020200008038, protein_id|ZP_05230100.1, gi|254825099, CDD:128803
1619 45295 45561 267 + 3         Protein gp37 [Bacteriophage A118] locus|LmonFS_020200008043, protein_id|ZP_05230101.1, gi|254825100
1620 45720 45490 231 - -72         Phage protein locus|LmonFS_020200008048, protein_id|ZP_05230102.1, gi|254825101
1621 45786 45980 195 + 65         FIG00774265: hypothetical protein locus|LmonFS_020200008053, protein_id|ZP_05230103.1, gi|254825102
1622 45992 46276 285 + 11         FIG00774252: hypothetical protein locus|LmonFS_020200008058, protein_id|ZP_05230104.1, gi|254825103
1623 46302 46583 282 + 25         Protein gp41 [Bacteriophage A118] locus|LmonFS_020200008063, protein_id|ZP_05230105.1, gi|254825104
1624 46615 46776 162 + 31         FIG00775553: hypothetical protein locus|LmonFS_020200008068, protein_id|ZP_05230106.1, gi|254825105
1625 47011 46769 243 - -8         Hypothetical protein, Lin0079 homolog [Bacteriophage A118] locus|LmonFS_020200008073, protein_id|ZP_05230107.1, gi|254825106
1626 47075 47854 780 + 63         Phage antirepressor protein / Antirepressor [Bacteriophage A118] locus|LmonFS_020200008078, protein_id|ZP_05230108.1, gi|254825107, CDD:112200
1627 47975 48508 534 + 120         Protein gp43 [Bacteriophage A118] locus|LmonFS_020200008083, protein_id|ZP_05230109.1, gi|254825108
1628 48505 48720 216 + -4         Protein gp44 [Bacteriophage A118] locus|LmonFS_020200008088, protein_id|ZP_05230110.1, gi|254825109
1629 48829 49017 189 + 108         Protein gp45 [Bacteriophage A118] locus|LmonFS_020200008093, protein_id|ZP_05230111.1, gi|254825110, CDD:119173
1630 49250 49438 189 + 232         FIG00776009: hypothetical protein locus|LmonFS_020200008098, protein_id|ZP_05230112.1, gi|254825111
1631 49435 50316 882 + -4         FIG00775957: hypothetical protein locus|LmonFS_020200008103, protein_id|ZP_05230113.1, gi|254825112
1632 50387 51079 693 + 70         Prophage Lp1 protein 19 locus|LmonFS_020200008108, protein_id|ZP_05230114.1, gi|254825113
1633 51100 52020 921 + 20         DnaD domain protein locus|LmonFS_020200008113, protein_id|ZP_05230115.1, gi|254825114, CDD:113268

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|393117.11.peg.1623 Protein gp41 [Bacteriophage A118]
MNNIKQAIIKLETILENGNEKENRLFVKYNTIKNILDLLEKDQELKIIEMEVELNGVEDS
IENAALLEKRLSEAKSLVEDLANTINSLEIKVK

MD5 = 4974ce510dd3c5a0cfa8ebd5c40b0cdf


  DNA Sequence

>fig|393117.11.peg.1623 Protein gp41 [Bacteriophage A118]
atgaataacatcaaacaagcaattattaaattagaaacaattttagaaaatggtaatgaa
aaagagaatagattattcgttaagtacaacactataaaaaacattttagatttacttgaa
aaagatcaagagctaaaaatcatcgaaatggaagtagagctgaatggagtagaggattcc
atagaaaacgccgctttgttagaaaagagattaagtgaagccaaatctttggtggaagac
ttggctaacactataaactcgttagaaattaaggtgaagtga


  DNA with Flanking Sequence

>fig|393117.11.peg.1623 Protein gp41 [Bacteriophage A118]
ttacaaactctttcctaactaagagaaatagaaaagagtcagtactcaccattgaattaa
gtataactggcgaagattttagcgatttaagtattttgccggaactttattcagaaatta
attcattagttaatagattatcggaaaaaactaacggcgatttgggcaaaagaaaatagg
aggctagaaaatgaacataagatatttgagtaataaaagaagtgaagagaaagaatcagt
ttttaaaaccaaaatcatacctccagaaatcttgaaatcgttaaatattaaaatgcaagg
agatagaaactgctgttatggagtattagaaatcaatggaaaacaattaagaaaaggaat
tacagcggtcaagttagatttaaaagcaggatcattaccagttgtacaagtggaatatca
cccattcacgatcagcgaagaaatgcaaagactaatatggtctggaaaatactaaaaatc
ataatttaggaggaagaaaaatgaataacatcaaacaagcaattattaaattagaaacaa
ttttagaaaatggtaatgaaaaagagaatagattattcgttaagtacaacactataaaaa
acattttagatttacttgaaaaagatcaagagctaaaaatcatcgaaatggaagtagagc
tgaatggagtagaggattccatagaaaacgccgctttgttagaaaagagattaagtgaag
ccaaatctttggtggaagacttggctaacactataaactcgttagaaattaaggtgaagt
gaagcttttccaaaaagaataggaggttaaaaaatgaaggactttgaaatgatggaagca
attaaacaaaaacggcttgaatgtaaattagtaattttggaaaattttgaatcgagtttt
aaagaagccctcaataagggagattccgccatggtgtcggctttagcggaatcattgaaa
acagttattaaatagtgaactcaatgtaaaggacatcatttgagttcattagaaaaactt
tcgataaatcgttttctaactcgtttgcacccttataaatgattttgtaagttttatcgg
cttctaaataaaaatcatttaaatcaaaacttttgttatctggaaaagatgtaatgctta
taacgcccattagagcaatgggctggtcatcagagatacctttgaacattatatccatgc
gatttttcacaaattccacctcccttcacaaaaactatagcactgtgaaagggcgaacag
aaaggagaacaaaatgtcaaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|393117.3.peg.2541 Listeria monocytogenes FSL J1-194 FIG   Protein gp41 [Bacteriophage A118]
fig|393125.10.peg.2711 Listeria monocytogenes FSL R2-503 FIG   Protein gp41 [Bacteriophage A118]
fig|393125.3.peg.3400 Listeria monocytogenes FSL R2-503 FIG   Protein gp41 [Bacteriophage A118]
fig|393130.8.peg.2920 Listeria monocytogenes J0161 FIG   Protein gp41 [Bacteriophage A118]
fig|393131.7.peg.2892 Listeria monocytogenes J2818 FIG   Protein gp41 [Bacteriophage A118]
fig|401650.12.peg.2920 Listeria monocytogenes HPB2262 FIG   Protein gp41 [Bacteriophage A118]
fig|401650.3.peg.2352 Listeria monocytogenes Aureli 1997 FIG   Protein gp41 [Bacteriophage A118]
gb|EEW20273.1 Listeria monocytogenes FSL R2-503     conserved hypothetical protein
gi|254825104 Listeria monocytogenes FSL J1-194 NCBI   hypothetical protein LmonFS_08063
gi|254854273 Listeria monocytogenes FSL R2-503 NCBI   conserved hypothetical protein
gi|254901052 Listeria monocytogenes J0161 NCBI   hypothetical protein LmonJ_14598
gi|254913998 Listeria monocytogenes J2818 NCBI   hypothetical protein LmonJ2_14418
gi|254933753 Listeria monocytogenes HPB2262 NCBI   hypothetical protein LmonH_15073
gi|258607665 Listeria monocytogenes FSL R2-503 NCBI   conserved hypothetical protein
img|640983398 Listeria monocytogenes HPB2262 IMG   hypothetical protein
img|641752709 Listeria monocytogenes FSL J1-194 IMG   hypothetical protein
img|641767666 Listeria monocytogenes FSL R2-503 IMG   hypothetical protein
ref|ZP_05230105.1 Listeria monocytogenes FSL J1-194 RefSeq   hypothetical protein LmonFS_08063
ref|ZP_05243621.1 Listeria monocytogenes FSL R2-503 RefSeq   conserved hypothetical protein
ref|ZP_05260976.1 Listeria monocytogenes J0161 RefSeq   hypothetical protein LmonJ_14598
ref|ZP_05264010.1 Listeria monocytogenes J2818 RefSeq   hypothetical protein LmonJ2_14418
ref|ZP_05267112.1 Listeria monocytogenes HPB2262 RefSeq   hypothetical protein LmonH_15073


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search