The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|393117.11.peg.1616: Listeria monocytogenes FSL J1-194

This feature in The SEED Viewer

NCBI Taxonomy Id: 393117

Current Assignment: Phage protein
Translate Function Assignments



Context on contig NZ_AARJ02000004 from base 38058 to 50316 (12259 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1609 38058 39956 1899 +           PTS system, fructose-specific IIA component / PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component locus|LmonFS_020200007993, protein_id|ZP_05230091.1, gi|254825090, CDD:137510
1610 40062 40409 348 + 105         Phage transcriptional regulator cro locus|LmonFS_020200007998, protein_id|ZP_05230092.1, gi|254825091, CDD:28977
1611 40940 40464 477 - 54         Competence transcription factor locus|LmonFS_020200008003, protein_id|ZP_05230093.1, gi|254825092, CDD:34512
1612 42289 40931 1359 - -10         Integrase [Bacteriophage A118] locus|LmonFS_020200008008, protein_id|ZP_05230094.1, gi|254825093, CDD:129090
1613 43093 42353 741 - 63         putative superinfection immunity protein locus|LmonFS_020200008013, protein_id|ZP_05230095.1, gi|254825094
1614 43837 43115 723 - 21         Phage A118 gp33 protein homolog locus|LmonFS_020200008018, protein_id|ZP_05230096.1, gi|254825095, CDD:118382
1615 44071 43853 219 - 15         Protein gp34 [Bacteriophage A118] locus|LmonFS_020200008023, protein_id|ZP_05230097.1, gi|254825096
1616 44585 44094 492 - 22       Phage protein locus|LmonFS_020200008028, protein_id|ZP_05230098.1, gi|254825097, CDD:114812
1617 44923 44618 306 - 32 5     Repressor (CI-like) [Bacteriophage A118] locus|LmonFS_020200008033, protein_id|ZP_05230099.1, gi|254825098, CDD:128803
1618 45049 45291 243 + 125         Repressor (cro-like) [Bacteriophage A118] locus|LmonFS_020200008038, protein_id|ZP_05230100.1, gi|254825099, CDD:128803
1619 45295 45561 267 + 3         Protein gp37 [Bacteriophage A118] locus|LmonFS_020200008043, protein_id|ZP_05230101.1, gi|254825100
1620 45720 45490 231 - -72         Phage protein locus|LmonFS_020200008048, protein_id|ZP_05230102.1, gi|254825101
1621 45786 45980 195 + 65         FIG00774265: hypothetical protein locus|LmonFS_020200008053, protein_id|ZP_05230103.1, gi|254825102
1622 45992 46276 285 + 11         FIG00774252: hypothetical protein locus|LmonFS_020200008058, protein_id|ZP_05230104.1, gi|254825103
1623 46302 46583 282 + 25         Protein gp41 [Bacteriophage A118] locus|LmonFS_020200008063, protein_id|ZP_05230105.1, gi|254825104
1624 46615 46776 162 + 31         FIG00775553: hypothetical protein locus|LmonFS_020200008068, protein_id|ZP_05230106.1, gi|254825105
1625 47011 46769 243 - -8         Hypothetical protein, Lin0079 homolog [Bacteriophage A118] locus|LmonFS_020200008073, protein_id|ZP_05230107.1, gi|254825106
1626 47075 47854 780 + 63         Phage antirepressor protein / Antirepressor [Bacteriophage A118] locus|LmonFS_020200008078, protein_id|ZP_05230108.1, gi|254825107, CDD:112200
1627 47975 48508 534 + 120         Protein gp43 [Bacteriophage A118] locus|LmonFS_020200008083, protein_id|ZP_05230109.1, gi|254825108
1628 48505 48720 216 + -4         Protein gp44 [Bacteriophage A118] locus|LmonFS_020200008088, protein_id|ZP_05230110.1, gi|254825109
1629 48829 49017 189 + 108         Protein gp45 [Bacteriophage A118] locus|LmonFS_020200008093, protein_id|ZP_05230111.1, gi|254825110, CDD:119173
1630 49250 49438 189 + 232         FIG00776009: hypothetical protein locus|LmonFS_020200008098, protein_id|ZP_05230112.1, gi|254825111
1631 49435 50316 882 + -4         FIG00775957: hypothetical protein locus|LmonFS_020200008103, protein_id|ZP_05230113.1, gi|254825112

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|393117.11.peg.1616 Phage protein
MNKTSYELKQEFPELNFVINNNLPTKLFGLIQNKVVHLHPDLSENELRCTIIEEAMHWKY
TAGDITKFNNVENIKQEKFARRKAHEYLVNIQSLALCYDLGYRTYYEAATFLNVTEKFLI
EAVENYREKYGLMYNNGNYIIHFGSTIQVFQEDNSFYPYDYGC

MD5 = c5494ac521e4b4fdd5c7040194317be4


  DNA Sequence

>fig|393117.11.peg.1616 Phage protein
atgaataaaacaagttatgaattaaagcaagagtttccagaattgaattttgttataaat
aacaacttaccaacaaaacttttcggacttatacagaataaagtagtacatcttcatcct
gatttgtcagaaaatgaacttagatgtactataatagaagaagcaatgcactggaaatat
accgctggagatataacaaaatttaataatgtagaaaatatcaagcaggagaaatttgcg
cgtcgtaaagcgcatgaatatttagtaaatatacaatcactcgctttatgctacgatctt
ggctacagaacatattatgaagctgctacttttttaaatgttactgaaaaatttttgatt
gaagcagtagagaattatagagaaaaatatggactaatgtataataatggtaattatatt
atacattttggctctaccattcaagttttccaggaggataactctttttatccttatgat
tatgggtgctaa


  DNA with Flanking Sequence

>fig|393117.11.peg.1616 Phage protein
caatgcgaatttttttgagattattaatattaatcaccgcctttatcactctatgtgata
ataatactatcactttacgtgattgtcaatcactttttgtgatttttgtttatttttttt
aaaatatcacttatagtgatacttaagaaggagggagatattatgactataggcaaaaaa
atatctgagttgagaaataaaagaggtatctctcaaattcaacttgcaaaagatttaaat
gtttcaacaagtactataggaatgtgggaaacagacaaacgtgctataaaagatgaatta
atcgttcagttagccgattactttaatgtaacaactgattatttattaggtcgtgaaaaa
ttcgacaacagcgacttactagctgcgcatattgacaatgatttgacggaagaagaacga
atagagatagaaaaatatttaaaatttatcagatcacaaaaagagtagttgcctaaaaat
taacattagggggctaattgatgaataaaacaagttatgaattaaagcaagagtttccag
aattgaattttgttataaataacaacttaccaacaaaacttttcggacttatacagaata
aagtagtacatcttcatcctgatttgtcagaaaatgaacttagatgtactataatagaag
aagcaatgcactggaaatataccgctggagatataacaaaatttaataatgtagaaaata
tcaagcaggagaaatttgcgcgtcgtaaagcgcatgaatatttagtaaatatacaatcac
tcgctttatgctacgatcttggctacagaacatattatgaagctgctacttttttaaatg
ttactgaaaaatttttgattgaagcagtagagaattatagagaaaaatatggactaatgt
ataataatggtaattatattatacattttggctctaccattcaagttttccaggaggata
actctttttatccttatgattatgggtgctaataaattttgacgaggtgaacatatgtat
tgccctaaatgcggacatgcactagacaatcacgaaaatcaatgtcctaactgtctaaca
ccaatcatttatcaaagcaacaacaacggaaaagcacaaaaagccggcgaaattatggaa
gaatctggtaaattaatgtcaggatgtggttgtttaatgacattgttgataactattcct
gtcatagtaattttaataattatgtttttataaaaaggagataacgggatgagtaagtat
agttacttgttaaaaaaatggtggttttgggctcttgctatattatttttagttatttta
ttttacagcttttgggtaataatatacttggtggcactagcttccttaatattcgggata
gtaaaagttgttaaaaatgaaaacagacgaaaatacacaataatattgactatatccgct
atatttctaatcaccttttcactaataagagttgtacagatgtataactatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
emb|CAB53821.1 Listeria phage A118 EMBL   gp35
fig|393117.3.peg.2548 Listeria monocytogenes FSL J1-194 FIG   Phage protein
fig|393130.3.peg.1881 Listeria monocytogenes J0161 FIG   Phage protein
fig|393130.8.peg.2913 Listeria monocytogenes J0161 FIG   Phage protein
fig|393131.3.peg.2235 Listeria monocytogenes J2818 FIG   Phage protein
fig|393131.7.peg.2899 Listeria monocytogenes J2818 FIG   Phage protein
fig|401650.3.peg.2359 Listeria monocytogenes Aureli 1997 FIG   Phage protein
fig|40521.1.peg.35 Bacteriophage A118 FIG   Phage protein
gi|16798818 Listeria phage A118 NCBI   gp35
gi|254825097 Listeria monocytogenes FSL J1-194 NCBI   bacteriophage gp35-type protein
gi|254901045 Listeria monocytogenes J0161 NCBI   bacteriophage gp35-type protein
gi|254914005 Listeria monocytogenes J2818 NCBI   bacteriophage gp35-type protein
gi|254933699 Listeria monocytogenes HPB2262 NCBI   bacteriophage gp35-type protein
gi|5823633 Listeria phage A118 NCBI   gp35
img|638289513 Listeria phage A118 IMG   gp35
img|640974076 Listeria monocytogenes J0161 IMG   gp35
img|640976186 Listeria monocytogenes J2818 IMG   hypothetical protein
img|640983404 Listeria monocytogenes HPB2262 IMG   gp35 (Bacteriophage A118)
img|641752716 Listeria monocytogenes FSL J1-194 IMG   bacteriophage gp35-type protein
ref|NP_463496.1 Listeria phage A118 RefSeq   gp35
ref|ZP_05230098.1 Listeria monocytogenes FSL J1-194 RefSeq   bacteriophage gp35-type protein
ref|ZP_05260969.1 Listeria monocytogenes J0161 RefSeq   bacteriophage gp35-type protein
ref|ZP_05264017.1 Listeria monocytogenes J2818 RefSeq   bacteriophage gp35-type protein
ref|ZP_05267058.1 Listeria monocytogenes HPB2262 RefSeq   bacteriophage gp35-type protein
tr|Q9T189 Listeria phage A118 (Bacteriophage A118) TrEMBL   Gp35


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|393117.11.peg.1617 Repressor (CI-like) [Bacteriophage A118]


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search