The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|393117.11.peg.1613: Listeria monocytogenes FSL J1-194

This feature in The SEED Viewer

NCBI Taxonomy Id: 393117

Current Assignment: putative superinfection immunity protein
Translate Function Assignments



Context on contig NZ_AARJ02000004 from base 37133 to 48508 (11376 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1608 37133 38056 924 +           Tagatose-6-phosphate kinase (EC 2.7.1.144) / 1-phosphofructokinase (EC 2.7.1.56) locus|LmonFS_020200007988, protein_id|ZP_05230090.1, gi|254825089, CDD:132212
1609 38058 39956 1899 + 1         PTS system, fructose-specific IIA component / PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component locus|LmonFS_020200007993, protein_id|ZP_05230091.1, gi|254825090, CDD:137510
1610 40062 40409 348 + 105         Phage transcriptional regulator cro locus|LmonFS_020200007998, protein_id|ZP_05230092.1, gi|254825091, CDD:28977
1611 40940 40464 477 - 54         Competence transcription factor locus|LmonFS_020200008003, protein_id|ZP_05230093.1, gi|254825092, CDD:34512
1612 42289 40931 1359 - -10         Integrase [Bacteriophage A118] locus|LmonFS_020200008008, protein_id|ZP_05230094.1, gi|254825093, CDD:129090
1613 43093 42353 741 - 63         putative superinfection immunity protein locus|LmonFS_020200008013, protein_id|ZP_05230095.1, gi|254825094
1614 43837 43115 723 - 21         Phage A118 gp33 protein homolog locus|LmonFS_020200008018, protein_id|ZP_05230096.1, gi|254825095, CDD:118382
1615 44071 43853 219 - 15         Protein gp34 [Bacteriophage A118] locus|LmonFS_020200008023, protein_id|ZP_05230097.1, gi|254825096
1616 44585 44094 492 - 22         Phage protein locus|LmonFS_020200008028, protein_id|ZP_05230098.1, gi|254825097, CDD:114812
1617 44923 44618 306 - 32         Repressor (CI-like) [Bacteriophage A118] locus|LmonFS_020200008033, protein_id|ZP_05230099.1, gi|254825098, CDD:128803
1618 45049 45291 243 + 125         Repressor (cro-like) [Bacteriophage A118] locus|LmonFS_020200008038, protein_id|ZP_05230100.1, gi|254825099, CDD:128803
1619 45295 45561 267 + 3         Protein gp37 [Bacteriophage A118] locus|LmonFS_020200008043, protein_id|ZP_05230101.1, gi|254825100
1620 45720 45490 231 - -72         Phage protein locus|LmonFS_020200008048, protein_id|ZP_05230102.1, gi|254825101
1621 45786 45980 195 + 65         FIG00774265: hypothetical protein locus|LmonFS_020200008053, protein_id|ZP_05230103.1, gi|254825102
1622 45992 46276 285 + 11         FIG00774252: hypothetical protein locus|LmonFS_020200008058, protein_id|ZP_05230104.1, gi|254825103
1623 46302 46583 282 + 25         Protein gp41 [Bacteriophage A118] locus|LmonFS_020200008063, protein_id|ZP_05230105.1, gi|254825104
1624 46615 46776 162 + 31         FIG00775553: hypothetical protein locus|LmonFS_020200008068, protein_id|ZP_05230106.1, gi|254825105
1625 47011 46769 243 - -8         Hypothetical protein, Lin0079 homolog [Bacteriophage A118] locus|LmonFS_020200008073, protein_id|ZP_05230107.1, gi|254825106
1626 47075 47854 780 + 63         Phage antirepressor protein / Antirepressor [Bacteriophage A118] locus|LmonFS_020200008078, protein_id|ZP_05230108.1, gi|254825107, CDD:112200
1627 47975 48508 534 + 120         Protein gp43 [Bacteriophage A118] locus|LmonFS_020200008083, protein_id|ZP_05230109.1, gi|254825108

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|393117.11.peg.1613 putative superinfection immunity protein
MKKGMVLLTGFLLAFSIFLVGCGNEKNDIQVTNTNDKSNFKEKEEAQMKLTETEITPNDK
GDFSIMGVVDEGASVYIESEEAEVNSSGMFVASSNYTGSEEIQYTVTAKEAGKTDNVQIV
TILPPTLKEYSVGDTQEIGGIKVTLTSVEKTNERNQFDDTKPKNVVKISYKVENNSGSEY
FVDSDIDVYDSKGTMGERYPLDNTTGKIPNGKNMNAQFHAGINESGNIEIIFNLFSDANL
TFHAKI

MD5 = 2f249fa23bd91d58de29cf151d59725d


  DNA Sequence

>fig|393117.11.peg.1613 putative superinfection immunity protein
atgaaaaaagggatggttttattaacggggtttttattagcttttagtatttttttagta
ggttgtggaaatgaaaaaaatgatatacaagttacaaataccaatgataaaagtaatttc
aaagaaaaagaagaagctcaaatgaagttaacagaaacagaaattacaccaaatgataaa
ggcgactttagcataatgggcgttgtcgatgaaggtgcatctgtttatattgagtcagaa
gaagcagaagttaattcatcggggatgttcgttgcttctagcaactacaccggctcggaa
gaaattcaatatactgttacagctaaagaagctggaaaaactgataatgtacaaattgta
actatacttccacccactctgaaagaatacagcgttggtgatacacaagaaatcggcggg
ataaaagtaactttaactagtgttgagaaaacgaacgaaagaaatcaatttgatgatacc
aagcctaagaatgtagttaaaataagttataaagttgaaaataattctggatccgagtat
tttgttgattctgatattgatgtatatgattctaaaggcacgatgggtgaaagataccca
ctcgacaacacgaccggaaaaataccaaacggaaaaaatatgaatgcacaattccatgca
gggattaatgaaagcggaaatattgaaatcatctttaacttattttccgatgcaaattta
acttttcatgcaaaaatttaa


  DNA with Flanking Sequence

>fig|393117.11.peg.1613 putative superinfection immunity protein
ttattaataatccagaagaaactacagcaaatgagcaaaaaaagaatactgtccaagatg
agcaaacggaaaaacccgctcaagaagacgctgccgaggacgagcaagcagaagaacctg
ctcaagatgatgtatctacaccctctaaaattacatcagatagtatagagttatttaatg
agtcaattgatcgcttgatttctgattcgagcggggtactaataaaagtggttccatttg
aaaatgaatatgatatgttaattgcgtacgtatctcaagatttaaaatatcaagatgaag
caactaaacaaaaaaatgttgattatttaggaagcgaaatacagcaacgtgctctaggta
cgctctttggtggagataacaatctaagaccaatggttgagttcagatataaagatgaga
caaagatggctggaagtagtgcttttgataaaactaatatgaagctcaaaggaaaataaa
atataaagggagcagataagatgaaaaaagggatggttttattaacggggtttttattag
cttttagtatttttttagtaggttgtggaaatgaaaaaaatgatatacaagttacaaata
ccaatgataaaagtaatttcaaagaaaaagaagaagctcaaatgaagttaacagaaacag
aaattacaccaaatgataaaggcgactttagcataatgggcgttgtcgatgaaggtgcat
ctgtttatattgagtcagaagaagcagaagttaattcatcggggatgttcgttgcttcta
gcaactacaccggctcggaagaaattcaatatactgttacagctaaagaagctggaaaaa
ctgataatgtacaaattgtaactatacttccacccactctgaaagaatacagcgttggtg
atacacaagaaatcggcgggataaaagtaactttaactagtgttgagaaaacgaacgaaa
gaaatcaatttgatgataccaagcctaagaatgtagttaaaataagttataaagttgaaa
ataattctggatccgagtattttgttgattctgatattgatgtatatgattctaaaggca
cgatgggtgaaagatacccactcgacaacacgaccggaaaaataccaaacggaaaaaata
tgaatgcacaattccatgcagggattaatgaaagcggaaatattgaaatcatctttaact
tattttccgatgcaaatttaacttttcatgcaaaaatttaaaagagagcctcctggcttt
tctttttaccgaaaaaagaacatacgtacggaaggagaaaggaaatgaaggcagctattt
atatacgtgtttctactcaagagcaagtagaaaattattcaatacaagctcaaactgaaa
aactaacagcattgtgccgctcgaaggactgggacgtatacgatattttcattgacggcg
gatactccggctcaaatatgaatcgtcccgcattaaatgaaatgctaagtaaactacacg
aaattgatgctgtagtcgtatatcgattagacagactatcccgctcacaaagagatacga
taacgcttattgaagaatacttcttaaaaaacaatgtagaatttgttagtctgtctgaaa
cgcttgatactagttcacccttcggtcgtgcaatgattggtatattgtccgtattcgctc
aattagagcgcgaaactatacgagatcgaatggtgatggggaaaattaagcgtattgaag
c


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
emb|CAB53818.1 Listeria phage A118 EMBL   gp32
fig|393130.3.peg.1878 Listeria monocytogenes J0161 FIG   putative superinfection immunity protein
fig|393130.8.peg.2910 Listeria monocytogenes J0161 FIG   putative superinfection immunity protein
fig|393131.3.peg.2238 Listeria monocytogenes J2818 FIG   putative superinfection immunity protein
fig|393131.7.peg.2902 Listeria monocytogenes J2818 FIG   putative superinfection immunity protein
fig|40521.1.peg.32 Bacteriophage A118 FIG   putative superinfection immunity protein
gi|16798815 Listeria phage A118 NCBI   gp32
gi|254825094 Listeria monocytogenes FSL J1-194 NCBI   putative lipoprotein, gp32
gi|254901042 Listeria monocytogenes J0161 NCBI   putative lipoprotein, gp32
gi|254914008 Listeria monocytogenes J2818 NCBI   putative lipoprotein, gp32
gi|5823630 Listeria phage A118 NCBI   gp32
img|638289510 Listeria phage A118 IMG   gp32
img|640974073 Listeria monocytogenes J0161 IMG   hypothetical protein
img|640976187 Listeria monocytogenes J2818 IMG   gp32 (Bacteriophage A118)
ref|NP_463493.1 Listeria phage A118 RefSeq   gp32
ref|ZP_05230095.1 Listeria monocytogenes FSL J1-194 RefSeq   putative lipoprotein, gp32
ref|ZP_05260966.1 Listeria monocytogenes J0161 RefSeq   putative lipoprotein, gp32
ref|ZP_05264020.1 Listeria monocytogenes J2818 RefSeq   putative lipoprotein, gp32
tr|Q9T192 Listeria phage A118 (Bacteriophage A118) TrEMBL   Gp32


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search