The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|393117.11.peg.1611: Listeria monocytogenes FSL J1-194

This feature in The SEED Viewer

NCBI Taxonomy Id: 393117

Current Assignment: Competence transcription factor
Translate Function Assignments



Context on contig NZ_AARJ02000004 from base 34887 to 45980 (11094 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1606 36212 34887 1326 -       1: 1   Aminopeptidase C (EC 3.4.22.40) locus|LmonFS_020200007978, protein_id|ZP_05230088.1, gi|254825087, CDD:111893
1607 36384 37136 753 + 171         Transcriptional repressor of the fructose operon, DeoR family locus|LmonFS_020200007983, protein_id|ZP_05230089.1, gi|254825088, CDD:31540
1608 37133 38056 924 + -4         Tagatose-6-phosphate kinase (EC 2.7.1.144) / 1-phosphofructokinase (EC 2.7.1.56) locus|LmonFS_020200007988, protein_id|ZP_05230090.1, gi|254825089, CDD:132212
1609 38058 39956 1899 + 1         PTS system, fructose-specific IIA component / PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component locus|LmonFS_020200007993, protein_id|ZP_05230091.1, gi|254825090, CDD:137510
1610 40062 40409 348 + 105         Phage transcriptional regulator cro locus|LmonFS_020200007998, protein_id|ZP_05230092.1, gi|254825091, CDD:28977
1611 40940 40464 477 - 54         Competence transcription factor locus|LmonFS_020200008003, protein_id|ZP_05230093.1, gi|254825092, CDD:34512
1612 42289 40931 1359 - -10         Integrase [Bacteriophage A118] locus|LmonFS_020200008008, protein_id|ZP_05230094.1, gi|254825093, CDD:129090
1613 43093 42353 741 - 63         putative superinfection immunity protein locus|LmonFS_020200008013, protein_id|ZP_05230095.1, gi|254825094
1614 43837 43115 723 - 21         Phage A118 gp33 protein homolog locus|LmonFS_020200008018, protein_id|ZP_05230096.1, gi|254825095, CDD:118382
1615 44071 43853 219 - 15         Protein gp34 [Bacteriophage A118] locus|LmonFS_020200008023, protein_id|ZP_05230097.1, gi|254825096
1616 44585 44094 492 - 22         Phage protein locus|LmonFS_020200008028, protein_id|ZP_05230098.1, gi|254825097, CDD:114812
1617 44923 44618 306 - 32         Repressor (CI-like) [Bacteriophage A118] locus|LmonFS_020200008033, protein_id|ZP_05230099.1, gi|254825098, CDD:128803
1618 45049 45291 243 + 125         Repressor (cro-like) [Bacteriophage A118] locus|LmonFS_020200008038, protein_id|ZP_05230100.1, gi|254825099, CDD:128803
1619 45295 45561 267 + 3         Protein gp37 [Bacteriophage A118] locus|LmonFS_020200008043, protein_id|ZP_05230101.1, gi|254825100
1620 45720 45490 231 - -72         Phage protein locus|LmonFS_020200008048, protein_id|ZP_05230102.1, gi|254825101
1621 45786 45980 195 + 65         FIG00774265: hypothetical protein locus|LmonFS_020200008053, protein_id|ZP_05230103.1, gi|254825102

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|393117.11.peg.1611 Competence transcription factor
MALVACLFRLFSSSFPLVGRKEGTKHLIGVTHKPPIIIDPVTSTYVFPTVAPSSTECIWI
FPQHIKDYHAIGFNHTLITFSNMETFEIDMSLASFNNQIARTSMLHMKFSQKMRIMESNF
PSMNRFFPPTTLAAEPRRYYSTMLPNNEDPNEPQDPEQ

MD5 = ce62de7381de93b4836b08815c868afb


  DNA Sequence

>fig|393117.11.peg.1611 Competence transcription factor
atggctctagtagcttgtttatttagattgtttagttcctcgtttcctctcgttggacgc
aaagagggaactaaacacttaattggtgttacccataagccacccattatcattgaccca
gtcacttctacttatgtatttccaactgtagcacctagttcaacagaatgtatttggatt
ttcccacaacatattaaagattatcatgcaattggatttaaccacactttaataacattt
tctaatatggaaacctttgagattgatatgtctttagcatcttttaataatcagattgct
agaacctccatgttacatatgaaattttctcaaaaaatgcgtataatggagagtaatttt
ccttcaatgaataggtttttcccaccaaccactcttgctgctgaacctagacgttattac
agcaccatgcttccaaataacgaagatcctaatgagcctcaagatcctgagcagtaa


  DNA with Flanking Sequence

>fig|393117.11.peg.1611 Competence transcription factor
cggagaaaagatactgtttcccgcggaaagaaatatcattatagatattatagttgcaag
acttacaaacatactcatgaactagaaaaatgtggaaataaaatttggagagctgacaaa
ctcgaggaattaattattgatcgcgtgaataactatagtttcgcttctaggaatgtagat
aaagaagacgaattagataacttaaatgaaaaacttaaaacagaacacacaaaaaagaag
cggctgtttgatttatatatcagtggttcttacgaagtttcagaacttgatgctatgatg
gctgatatcgatgctcaaattaattattatgaagcacaaatagaagctaacgaagaattg
aagaaaaataaaaagatacaagaaaatttagctgatttagcaacagttgattttgactct
ttagagttccgagaaaagcaactttatttaaaatcactaattaataaaatttatattgac
ggtgaacaagttactattgaatggctctagtagcttgtttatttagattgtttagttcct
cgtttcctctcgttggacgcaaagagggaactaaacacttaattggtgttacccataagc
cacccattatcattgacccagtcacttctacttatgtatttccaactgtagcacctagtt
caacagaatgtatttggattttcccacaacatattaaagattatcatgcaattggattta
accacactttaataacattttctaatatggaaacctttgagattgatatgtctttagcat
cttttaataatcagattgctagaacctccatgttacatatgaaattttctcaaaaaatgc
gtataatggagagtaattttccttcaatgaataggtttttcccaccaaccactcttgctg
ctgaacctagacgttattacagcaccatgcttccaaataacgaagatcctaatgagcctc
aagatcctgagcagtaactttaaaaccaaataaaagccagttacataatagtagctggct
tctccttaaaattattttttattttcaatcgcatctgcaattcgttttaacattaataac
tcatcctctgagtatgtataaggtaattctaaataccatttctcgagttcaggatttcca
attaaaggaaaggcgtttaccgaattcttttctcgcaaaccagctacatcatctaataaa
aaatcggttgttgttccaagaatttctgctaatttagccaaaataaaaattggcggtcgg
tggttatcattttcatacttgcttattgtggatgcagttgtcccgattttcgcagccagt
tgtttttgtgttaacctatttttctttcttaaatgaattaatttttctccaaattccaat
acgcccacctcacttcacttccagtatagcaatttttcggaaataattcgagaaattact
aaaaagaaatcgcctttttagtttcaaaagacgattt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|393117.3.peg.2553 Listeria monocytogenes FSL J1-194 FIG   Competence transcription factor
gi|254825092 Listeria monocytogenes FSL J1-194 NCBI   competence transcription factor (C-terminal part)
img|641752722 Listeria monocytogenes FSL J1-194 IMG   competence transcription factor (C-terminal part)
ref|ZP_05230093.1 Listeria monocytogenes FSL J1-194 RefSeq   competence transcription factor (C-terminal part)


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search