The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|391037.6.peg.3821: Salinispora arenicola CNS-205

This feature in The SEED Viewer

NCBI Taxonomy Id: 391037

Current Assignment: Prophage antirepressor protein
Translate Function Assignments



Context on contig NC_009953 from base 4312293 to 4326066 (13774 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3810 4314917 4312293 2625 -   4     Phage primase locus|Sare_3780, protein_id|YP_001538564.1, gi|159039311, InterPro:IPR006500, InterPro:IPR014015, InterPro:IPR014818, geneID|5703394
3811 4315596 4315024 573 - 106         hypothetical protein locus|Sare_3781, protein_id|YP_001538565.1, gi|159039312, geneID|5703908
3812 4316726 4315665 1062 - 68         hypothetical protein locus|Sare_3782, protein_id|YP_001538566.1, gi|159039313, geneID|5703909
3813 4316945 4316829 117 - 102         hypothetical protein  
3814 4317257 4317078 180 - 132         hypothetical protein locus|Sare_3784, protein_id|YP_001538568.1, gi|159039315, geneID|5703911
3815 4317529 4317254 276 - -4         FIG01042497: hypothetical protein locus|Sare_3785, protein_id|YP_001538569.1, gi|159039316, geneID|5703912
3816 4317924 4317529 396 - -1         hypothetical protein locus|Sare_3786, protein_id|YP_001538570.1, gi|159039317, InterPro:IPR001646, geneID|5703913
3817 4318376 4318146 231 - 221         FIG01043212: hypothetical protein locus|Sare_3787, protein_id|YP_001538571.1, gi|159039318, geneID|5703914
3818 4318617 4318378 240 - 1         FIG01042697: hypothetical protein locus|Sare_3788, protein_id|YP_001538572.1, gi|159039319, geneID|5703915
3819 4319057 4318614 444 - -4         hypothetical protein locus|Sare_3789, protein_id|YP_001538573.1, gi|159039320, geneID|5703916
3820 4319344 4319129 216 - 71         hypothetical protein locus|Sare_3790, protein_id|YP_001538574.1, gi|159039321, geneID|5703917
3821 4320099 4319341 759 - -4       Prophage antirepressor protein locus|Sare_3791, protein_id|YP_001538575.1, gi|159039322, InterPro:IPR003497, geneID|5703918
3822 4320356 4320189 168 - 89         hypothetical protein locus|Sare_3792, protein_id|YP_001538576.1, gi|159039323, geneID|5703919
3823 4320819 4322435 1617 + 462         Mobile element protein locus|Sare_3794, protein_id|YP_001538578.1, gi|159039325, InterPro:IPR002104, geneID|5704543
rna.39 4322549 4322473 77 - 37         tRNA-Met-CAT  
3824 4323932 4322691 1242 - 141     2: 1 2   Phytoene dehydrogenase and related proteins locus|Sare_3795, protein_id|YP_001538579.1, gi|159039326, InterPro:IPR002937, InterPro:IPR013027, geneID|5704545
3825 4326066 4323922 2145 - -11         Integral membrane protein Strop_2920/Strop_3419, MMPL dimer type locus|Sare_3796, protein_id|YP_001538580.1, gi|159039327, InterPro:IPR000731, InterPro:IPR004869, geneID|5704546

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|391037.6.peg.3821 Prophage antirepressor protein
MRTVTVGNEPWFVAVDVCRALEIGNPRQAVSYLDDDEVRQAPVTTDDGSDRVLMTNVVSE
AGLYSLILRSRKPEAKAFKRWVTHDVLPAIRATGRYESVPAVPQSYADALQLAADQARQL
DAQAAELAEAAPKAASWDTLASAEGDWSVRDAAKVLSRDPGLDLGERRLFTVLGEQQWIY
RQRADGRWRPYQRAIESGWLSELPSTHYHPRTGELVLDTPQVRVTTRGLHLLHRRLGGTQ
PLRTHEQTALIQ

MD5 = d1814a88e235c549fbd4f8d04376b826


  DNA Sequence

>fig|391037.6.peg.3821 Prophage antirepressor protein
ttgcggacggtcacggttggcaatgagccgtggttcgtcgctgtcgacgtgtgtagggca
ctggagatcggcaacccgcgccaagcggtgagctacctcgacgacgatgaggtgcggcag
gcacccgtcactactgatgacgggtcggaccgggtgctcatgacgaacgtcgtcagcgag
gccgggctgtactcactgattctccgtagtcgcaagccggaggcgaaggcgttcaagcgc
tgggtgacccacgacgtgttgcccgcgattcgggcgacgggccggtacgagtcggtgccg
gcggtgccgcagtcgtacgcggatgcgttgcagcttgccgcggatcaggcccggcagctt
gacgcgcaggccgccgagttggcggaggccgcgccgaaggcggcgtcgtgggacaccctc
gcctcggcggagggcgactggtccgtgcgggacgccgccaaggtgctatcgcgcgatccg
ggtctggacctcggggagcgacgcctgttcacggttctcggcgagcagcagtggatctat
cggcagcgtgctgacggtcgttggcggccgtaccagcgggcgatcgagtcgggctggctg
tcggagctgccctcgacgcactaccacccgcgcaccggtgagctggtgctcgatacgcct
caggtgcgggtcaccacccggggcctgcatctgctgcaccgccggcttggcggtacgcag
ccgttgcggacgcatgagcagacggcgctgatccagtga


  DNA with Flanking Sequence

>fig|391037.6.peg.3821 Prophage antirepressor protein
ttgcggtgacgtgcgccgatagtgcgcggtctcagctggaggactcttggtcctgcacgg
ctatgcatggcttacagggtagctctggtggccaggtgcagaatcatccgaacggccgat
gtgatgctatgcgtggcattgcgatacggtagtgccatgcatggcaacgcatcacacagc
aatgctgcgagtggcactgaatcggagcagatcgcctacaaggtgccgcgtgcagctgag
ctcttggacctgggcccgcggaccgtctggcaactcgtcaaggacgaggaagacgaaccc
ggtactggcatcgagtcgatcaaggtcggttggtcccgacgcgtgccccgtactgccctc
ctcgcctttatggaacggaagcgtgcccagggtcgggcggtgtccgaatgactcatcccc
aaggccccgccggacctggacctggcggcaccaccggtcccggccgcgagatcacaacct
ttgaattcggcgatctcccgttgcggacggtcacggttggcaatgagccgtggttcgtcg
ctgtcgacgtgtgtagggcactggagatcggcaacccgcgccaagcggtgagctacctcg
acgacgatgaggtgcggcaggcacccgtcactactgatgacgggtcggaccgggtgctca
tgacgaacgtcgtcagcgaggccgggctgtactcactgattctccgtagtcgcaagccgg
aggcgaaggcgttcaagcgctgggtgacccacgacgtgttgcccgcgattcgggcgacgg
gccggtacgagtcggtgccggcggtgccgcagtcgtacgcggatgcgttgcagcttgccg
cggatcaggcccggcagcttgacgcgcaggccgccgagttggcggaggccgcgccgaagg
cggcgtcgtgggacaccctcgcctcggcggagggcgactggtccgtgcgggacgccgcca
aggtgctatcgcgcgatccgggtctggacctcggggagcgacgcctgttcacggttctcg
gcgagcagcagtggatctatcggcagcgtgctgacggtcgttggcggccgtaccagcggg
cgatcgagtcgggctggctgtcggagctgccctcgacgcactaccacccgcgcaccggtg
agctggtgctcgatacgcctcaggtgcgggtcaccacccggggcctgcatctgctgcacc
gccggcttggcggtacgcagccgttgcggacgcatgagcagacggcgctgatccagtgac
cgccgccgctctgctggcccgcgcggtcgcccagatcgtgaccggtttggcgctggtcgc
cgctggtctcaccgcgccaccggtgccgccggccccggcctcggactcgagtcccggcct
ggagtggcgttccgccaccgacgccgagaggcgggagtggcagcgacagcgcctgttcga
cctcatcgacgcgaagcggtcgatgaagtgagccccccgccgatctgcggtcggcgaagg
gctcgacacccggaccagaacctgatcaaccaaggagtccagatgcaatcgcagagtaac
ccaaccactgagcggccagtctgcgccgccgcccaggccgacgctgagccggccacgccg
cacctggccgagccgggctacatgtcctgcccgcgtgagtgcggggtggacgtgcgcgag
cacaactcgtccggcctgatcgatggccggtgcgacacggactactggctggccctcgct
gccgacctgcgtgcggtgg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|391037.6.peg.3770 Salinispora arenicola CNS-205 FIG   Prophage antirepressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|391037.6.peg.3810 Phage primase


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search