The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|391037.6.peg.3819: Salinispora arenicola CNS-205

This feature in The SEED Viewer

NCBI Taxonomy Id: 391037

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_009953 from base 4312293 to 4326066 (13774 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3810 4314917 4312293 2625 -           Phage primase locus|Sare_3780, protein_id|YP_001538564.1, gi|159039311, InterPro:IPR006500, InterPro:IPR014015, InterPro:IPR014818, geneID|5703394
3811 4315596 4315024 573 - 106         hypothetical protein locus|Sare_3781, protein_id|YP_001538565.1, gi|159039312, geneID|5703908
3812 4316726 4315665 1062 - 68         hypothetical protein locus|Sare_3782, protein_id|YP_001538566.1, gi|159039313, geneID|5703909
3813 4316945 4316829 117 - 102         hypothetical protein  
3814 4317257 4317078 180 - 132         hypothetical protein locus|Sare_3784, protein_id|YP_001538568.1, gi|159039315, geneID|5703911
3815 4317529 4317254 276 - -4         FIG01042497: hypothetical protein locus|Sare_3785, protein_id|YP_001538569.1, gi|159039316, geneID|5703912
3816 4317924 4317529 396 - -1         hypothetical protein locus|Sare_3786, protein_id|YP_001538570.1, gi|159039317, InterPro:IPR001646, geneID|5703913
3817 4318376 4318146 231 - 221         FIG01043212: hypothetical protein locus|Sare_3787, protein_id|YP_001538571.1, gi|159039318, geneID|5703914
3818 4318617 4318378 240 - 1         FIG01042697: hypothetical protein locus|Sare_3788, protein_id|YP_001538572.1, gi|159039319, geneID|5703915
3819 4319057 4318614 444 - -4         hypothetical protein locus|Sare_3789, protein_id|YP_001538573.1, gi|159039320, geneID|5703916
3820 4319344 4319129 216 - 71         hypothetical protein locus|Sare_3790, protein_id|YP_001538574.1, gi|159039321, geneID|5703917
3821 4320099 4319341 759 - -4         Prophage antirepressor protein locus|Sare_3791, protein_id|YP_001538575.1, gi|159039322, InterPro:IPR003497, geneID|5703918
3822 4320356 4320189 168 - 89         hypothetical protein locus|Sare_3792, protein_id|YP_001538576.1, gi|159039323, geneID|5703919
3823 4320819 4322435 1617 + 462         Mobile element protein locus|Sare_3794, protein_id|YP_001538578.1, gi|159039325, InterPro:IPR002104, geneID|5704543
rna.39 4322549 4322473 77 - 37         tRNA-Met-CAT  
3824 4323932 4322691 1242 - 141     2: 1 2   Phytoene dehydrogenase and related proteins locus|Sare_3795, protein_id|YP_001538579.1, gi|159039326, InterPro:IPR002937, InterPro:IPR013027, geneID|5704545
3825 4326066 4323922 2145 - -11         Integral membrane protein Strop_2920/Strop_3419, MMPL dimer type locus|Sare_3796, protein_id|YP_001538580.1, gi|159039327, InterPro:IPR000731, InterPro:IPR004869, geneID|5704546

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|391037.6.peg.3819 hypothetical protein
MQSQSNPTTERPVCAAAQADAEPATPHLAEPGYMSCPRECGVDVREHNSSGLIDGRCDTD
YWLALAADLRAVADLVGSLAGTPAPEVHASLSLRVGSVVEAGHEERRPVVEAIAAALGGT
VWSDSHSQQEVVAGLRAAAEHARTVTA

MD5 = 06a3253063a73f95c15083e52f1801ed


  DNA Sequence

>fig|391037.6.peg.3819 hypothetical protein
atgcaatcgcagagtaacccaaccactgagcggccagtctgcgccgccgcccaggccgac
gctgagccggccacgccgcacctggccgagccgggctacatgtcctgcccgcgtgagtgc
ggggtggacgtgcgcgagcacaactcgtccggcctgatcgatggccggtgcgacacggac
tactggctggccctcgctgccgacctgcgtgcggtggctgacctggtgggctctctcgcc
ggcacgccggcccccgaggtgcacgcgagcctgtccctgcgtgtcgggtcggtcgtcgag
gctggacacgaggagcgccggcccgtggtggaggcgatcgccgccgcccttggtgggacg
gtgtggagtgacagccacagccagcaggaggtggtggctggtctgcgggccgccgccgag
cacgcccggacggtgacggcatga


  DNA with Flanking Sequence

>fig|391037.6.peg.3819 hypothetical protein
gcagcgtgctgacggtcgttggcggccgtaccagcgggcgatcgagtcgggctggctgtc
ggagctgccctcgacgcactaccacccgcgcaccggtgagctggtgctcgatacgcctca
ggtgcgggtcaccacccggggcctgcatctgctgcaccgccggcttggcggtacgcagcc
gttgcggacgcatgagcagacggcgctgatccagtgaccgccgccgctctgctggcccgc
gcggtcgcccagatcgtgaccggtttggcgctggtcgccgctggtctcaccgcgccaccg
gtgccgccggccccggcctcggactcgagtcccggcctggagtggcgttccgccaccgac
gccgagaggcgggagtggcagcgacagcgcctgttcgacctcatcgacgcgaagcggtcg
atgaagtgagccccccgccgatctgcggtcggcgaagggctcgacacccggaccagaacc
tgatcaaccaaggagtccagatgcaatcgcagagtaacccaaccactgagcggccagtct
gcgccgccgcccaggccgacgctgagccggccacgccgcacctggccgagccgggctaca
tgtcctgcccgcgtgagtgcggggtggacgtgcgcgagcacaactcgtccggcctgatcg
atggccggtgcgacacggactactggctggccctcgctgccgacctgcgtgcggtggctg
acctggtgggctctctcgccggcacgccggcccccgaggtgcacgcgagcctgtccctgc
gtgtcgggtcggtcgtcgaggctggacacgaggagcgccggcccgtggtggaggcgatcg
ccgccgcccttggtgggacggtgtggagtgacagccacagccagcaggaggtggtggctg
gtctgcgggccgccgccgagcacgcccggacggtgacggcatgagcgcctccacgtggcc
gctcacggccgacgccgccgccgagccgatcaccgtcgaggacccgctgtgtgggcatct
gcccggggagccccacgacggcgaggtgtgcgcctactggcggggggtcgcgaccggcga
gtacccgccgccggaggcctacatggagccggtgacgctgccgccgcactgccccgggct
ggagccgctgactgatccggctctgcgggaggtggtctgacatggcacgtcacgagcaga
cccactcgggccccggggtgtgccccggctgcctgaccgcgcccggccgcacccatggcc
tggcgtgtccggcggtggagggagcccgtcacgccgccgcgccgcatccgcacgcggaca
ccgttcgcatcgtctctgccctgctggtcggcgtgccgatcggcgccgctatctacctcg
tggccgccctgctgatctggagcctcacgtgaagagcttgcttgatgtcctgactgccga
ccgc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|391037.3.peg.3595 Salinispora arenicola CNS-205 FIG   hypothetical protein
fig|391037.3.peg.3646 Salinispora arenicola CNS-205 FIG   hypothetical protein
fig|391037.6.peg.3768 Salinispora arenicola CNS-205 FIG   hypothetical protein
gb|ABV99531.1 Salinispora arenicola CNS-205     hypothetical protein Sare_3738
gb|ABV99582.1 Salinispora arenicola CNS-205     hypothetical protein Sare_3789
gi|157918104 Salinispora arenicola CNS-205 NCBI   hypothetical protein Sare_3738
gi|157918155 Salinispora arenicola CNS-205 NCBI   hypothetical protein Sare_3789
gi|159039269 Salinispora arenicola CNS-205 NCBI   hypothetical protein Sare_3738
gi|159039320 Salinispora arenicola CNS-205 NCBI   hypothetical protein Sare_3789
img|640042551 Salinispora arenicola CNS205 IMG   hypothetical protein
img|641273158 Salinispora arenicola CNS-205 IMG   hypothetical protein
img|641273209 Salinispora arenicola CNS-205 IMG   hypothetical protein
kegg|saq:Sare_3738 Salinispora arenicola CNS-205 KEGG   hypothetical protein
kegg|saq:Sare_3789 Salinispora arenicola CNS-205 KEGG   hypothetical protein
ref|YP_001538522.1 Salinispora arenicola CNS-205 RefSeq   hypothetical protein Sare_3738
ref|YP_001538573.1 Salinispora arenicola CNS-205 RefSeq   hypothetical protein Sare_3789
tr|A8M017 Salinispora arenicola (strain CNS-205) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search