The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|391037.6.peg.3811: Salinispora arenicola CNS-205

This feature in The SEED Viewer

NCBI Taxonomy Id: 391037

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_009953 from base 4309829 to 4320356 (10528 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3805 4309829 4310095 267 +           hypothetical protein locus|Sare_3775, protein_id|YP_001538559.1, gi|159039306, geneID|5703389
3806 4310354 4310163 192 - 67         Phage protein locus|Sare_3776, protein_id|YP_001538560.1, gi|159039307, geneID|5703390
3807 4311235 4310351 885 - -4         hypothetical protein locus|Sare_3777, protein_id|YP_001538561.1, gi|159039308, geneID|5703391
3808 4311704 4311246 459 - 10         hypothetical protein locus|Sare_3778, protein_id|YP_001538562.1, gi|159039309, geneID|5703392
3809 4312054 4311719 336 - 14         hypothetical protein locus|Sare_3779, protein_id|YP_001538563.1, gi|159039310, geneID|5703393
3810 4314917 4312293 2625 - 238         Phage primase locus|Sare_3780, protein_id|YP_001538564.1, gi|159039311, InterPro:IPR006500, InterPro:IPR014015, InterPro:IPR014818, geneID|5703394
3811 4315596 4315024 573 - 106         hypothetical protein locus|Sare_3781, protein_id|YP_001538565.1, gi|159039312, geneID|5703908
3812 4316726 4315665 1062 - 68         hypothetical protein locus|Sare_3782, protein_id|YP_001538566.1, gi|159039313, geneID|5703909
3813 4316945 4316829 117 - 102         hypothetical protein  
3814 4317257 4317078 180 - 132         hypothetical protein locus|Sare_3784, protein_id|YP_001538568.1, gi|159039315, geneID|5703911
3815 4317529 4317254 276 - -4         FIG01042497: hypothetical protein locus|Sare_3785, protein_id|YP_001538569.1, gi|159039316, geneID|5703912
3816 4317924 4317529 396 - -1         hypothetical protein locus|Sare_3786, protein_id|YP_001538570.1, gi|159039317, InterPro:IPR001646, geneID|5703913
3817 4318376 4318146 231 - 221         FIG01043212: hypothetical protein locus|Sare_3787, protein_id|YP_001538571.1, gi|159039318, geneID|5703914
3818 4318617 4318378 240 - 1         FIG01042697: hypothetical protein locus|Sare_3788, protein_id|YP_001538572.1, gi|159039319, geneID|5703915
3819 4319057 4318614 444 - -4         hypothetical protein locus|Sare_3789, protein_id|YP_001538573.1, gi|159039320, geneID|5703916
3820 4319344 4319129 216 - 71         hypothetical protein locus|Sare_3790, protein_id|YP_001538574.1, gi|159039321, geneID|5703917
3821 4320099 4319341 759 - -4         Prophage antirepressor protein locus|Sare_3791, protein_id|YP_001538575.1, gi|159039322, InterPro:IPR003497, geneID|5703918
3822 4320356 4320189 168 - 89         hypothetical protein locus|Sare_3792, protein_id|YP_001538576.1, gi|159039323, geneID|5703919

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|391037.6.peg.3811 hypothetical protein
MNANELLMGGGVKSAAFPTVGTCVSGRVVREPEARQQTTPEGVAKTFDNGDPMMQIIVQV
HTDARDPQDADDDGVRALYIKGNMLSAVRDAVRKSGAKGIEVGATLTVTYTGDGEKKRAA
WSAPKLYSATYIAPPAPANNILMGQPTTPAPQAVPATPPPADTAPAGVDPALWAQMSTDQ
RAKLRAAMGQ

MD5 = 1989ee43466e5f505f0564934a8dfd13


  DNA Sequence

>fig|391037.6.peg.3811 hypothetical protein
atgaacgccaacgaactgctcatgggcggcggcgtcaagtccgccgctttccccaccgtc
ggcacctgcgtgtcgggtcgcgtcgtccgtgaaccggaagcccggcagcagaccacaccc
gaaggtgtggcgaagaccttcgacaacggcgacccgatgatgcagatcatcgtccaggtc
cacaccgacgctcgggatccgcaggacgccgacgacgacggtgtgcgcgccctctacatc
aagggcaacatgctgtccgctgtccgcgacgccgtccgcaagtccggcgccaagggcatc
gaggtcggcgcgaccctgaccgtcacctacaccggcgacggggagaagaaacgcgccgcc
tggagcgcgccgaagctctacagcgccacctacatcgccccacccgcaccggcgaacaac
atcctcatgggccagccgaccacgccagcgccccaggctgtcccggccacgccgccgccg
gccgacaccgcgccggccggcgtggacccggcgctgtgggcgcagatgagcaccgaccag
cgcgccaagctccgcgccgcgatgggccagtag


  DNA with Flanking Sequence

>fig|391037.6.peg.3811 hypothetical protein
aaactgcgtaccgccaaacggtccggtaggccgccggccgagcaggtgtcgcccgactac
cgggtgcagggccacctgtacgggctcggccacgaacgtaagggccggcgggtgcgtcac
gtccgtctcgtcctgttggcccggtcgtggcagtacgacgactccgacgagtggaccgag
ccgtacgacccggacatcgcccaccgggcgatcgaccgctactacgccaccgtgcaactg
ctcctcgacctggacgtggccgccaacccggcgttcatcgccgccgtcccggccacggcc
agcgccgacagctgcaagtggtgcccgttccatcggcccggccaacccaccggctgggac
gggtgcgccggtgacgccgccgcgcacaagcgacgcgttgaccgcttcaccgacgggctc
atcgcctcctgaacctccggccgcctgctggtggccggtcaaccgagcaccggaacaccg
gaacaaaggagaaccacagaatgaacgccaacgaactgctcatgggcggcggcgtcaagt
ccgccgctttccccaccgtcggcacctgcgtgtcgggtcgcgtcgtccgtgaaccggaag
cccggcagcagaccacacccgaaggtgtggcgaagaccttcgacaacggcgacccgatga
tgcagatcatcgtccaggtccacaccgacgctcgggatccgcaggacgccgacgacgacg
gtgtgcgcgccctctacatcaagggcaacatgctgtccgctgtccgcgacgccgtccgca
agtccggcgccaagggcatcgaggtcggcgcgaccctgaccgtcacctacaccggcgacg
gggagaagaaacgcgccgcctggagcgcgccgaagctctacagcgccacctacatcgccc
cacccgcaccggcgaacaacatcctcatgggccagccgaccacgccagcgccccaggctg
tcccggccacgccgccgccggccgacaccgcgccggccggcgtggacccggcgctgtggg
cgcagatgagcaccgaccagcgcgccaagctccgcgccgcgatgggccagtagttccggt
gcccccgcgtcgccggccagccccatcgcccgggactggccggcggccccggagccccgg
cacacccaccccggacagacaagcgcaggagtcagatagatgacgagcaccgagcagacg
gccaccggcctcgaccacaccatggtcaggacgtggctcgacgtgctctacgtcaacacc
cccggcctcgtccacatctcatccacaggtaactggtccggccgcgccttcaccgactac
gaccaggccaccgactacgtcaccgagctcgacaaagcccaaccggagggcatctacctg
cgcgccaccaccctcaggggccagcccggcaagggaggtcggggcggcgccgccgacagc
ctcgccctgcccggcctctgggccgacctcgacatcgccggccccggccacaaacacgac
gtgtgtcccgacgactgcaccaaaggtcatgggcacatcacccggcccctgccccccacc
gaggtcgacgccc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|391037.3.peg.3587 Salinispora arenicola CNS-205 FIG   hypothetical protein
fig|391037.3.peg.3638 Salinispora arenicola CNS-205 FIG   hypothetical protein
fig|391037.6.peg.3760 Salinispora arenicola CNS-205 FIG   hypothetical protein
gb|ABV99523.1 Salinispora arenicola CNS-205     hypothetical protein Sare_3730
gb|ABV99574.1 Salinispora arenicola CNS-205     hypothetical protein Sare_3781
gi|157918096 Salinispora arenicola CNS-205 NCBI   hypothetical protein Sare_3730
gi|157918147 Salinispora arenicola CNS-205 NCBI   hypothetical protein Sare_3781
gi|159039261 Salinispora arenicola CNS-205 NCBI   hypothetical protein Sare_3730
gi|159039312 Salinispora arenicola CNS-205 NCBI   hypothetical protein Sare_3781
img|640042558 Salinispora arenicola CNS205 IMG   hypothetical protein
img|641273150 Salinispora arenicola CNS-205 IMG   hypothetical protein
img|641273201 Salinispora arenicola CNS-205 IMG   hypothetical protein
kegg|saq:Sare_3730 Salinispora arenicola CNS-205 KEGG   hypothetical protein
kegg|saq:Sare_3781 Salinispora arenicola CNS-205 KEGG   hypothetical protein
ref|YP_001538514.1 Salinispora arenicola CNS-205 RefSeq   hypothetical protein Sare_3730
ref|YP_001538565.1 Salinispora arenicola CNS-205 RefSeq   hypothetical protein Sare_3781
tr|A8M009 Salinispora arenicola (strain CNS-205) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search