The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|391037.3.peg.3648: Salinispora arenicola CNS-205

This feature in The SEED Viewer

NCBI Taxonomy Id: 391037

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig CP000850 from base 4312293 to 4326066 (13774 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3637 4314917 4312293 2625 -           Phage primase Sare_3780, ABV99573.1, gi|157918146, InterPro:IPR006500, InterPro:IPR014015, InterPro:IPR014818
3638 4315596 4315024 573 - 106     1: 1   hypothetical protein Sare_3781, ABV99574.1, gi|157918147
3639 4316726 4315665 1062 - 68     1: 1   hypothetical protein Sare_3782, ABV99575.1, gi|157918148
3640 4316881 4316723 159 - -4     1: 1   hypothetical protein Sare_3783, ABV99576.1, gi|157918149
3641 4317257 4317078 180 - 196     1: 1   hypothetical protein Sare_3784, ABV99577.1, gi|157918150
3642 4317529 4317254 276 - -4         FIG01042497: hypothetical protein Sare_3785, ABV99578.1, gi|157918151
3643 4318149 4317529 621 - -1         Phage encoded pentapeptide repeat family protein Sare_3786, ABV99579.1, gi|157918152, InterPro:IPR001646
3644 4318376 4318146 231 - -4         FIG01043212: hypothetical protein Sare_3787, ABV99580.1, gi|157918153
3645 4318617 4318378 240 - 1         FIG01042697: hypothetical protein Sare_3788, ABV99581.1, gi|157918154
3646 4319057 4318614 444 - -4     1: 1   hypothetical protein Sare_3789, ABV99582.1, gi|157918155
3647 4319344 4319129 216 - 71     1: 1   hypothetical protein Sare_3790, ABV99583.1, gi|157918156
3648 4320192 4319341 852 - -4         Phage antirepressor protein Sare_3791, ABV99584.1, gi|157918157, InterPro:IPR003497
3649 4320467 4320189 279 - -4     1: 1   Phage excisionase Sare_3792, ABV99585.1, gi|157918158
3650 4320763 4321098 336 + 295     1: 1   hypothetical protein Sare_3793, ABV99586.1, gi|157918159
3651 4321098 4322435 1338 + -1         Phage integrase Sare_3794, ABV99587.1, gi|157918160, InterPro:IPR002104
rna.39 4322549 4322473 77 - 37     1: 4   tRNA-Met tRNA-Met
3652 4323932 4322691 1242 - 141     2: 2 3   Phytoene dehydrogenase and related proteins Sare_3795, ABV99588.1, gi|157918161, InterPro:IPR002937, InterPro:IPR013027
3653 4326066 4323922 2145 - -11         Integral membrane protein Strop_2920/Strop_3419, MMPL dimer type Sare_3796, ABV99589.1, gi|157918162, InterPro:IPR000731, InterPro:IPR004869

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|391037.3.peg.3648 Phage antirepressor protein
MTHPQGPAGPGPGGTTGPGREITTFEFGDLPLRTVTVGNEPWFVAVDVCRALEIGNPRQA
VSYLDDDEVRQAPVTTDDGSDRVLMTNVVSEAGLYSLILRSRKPEAKAFKRWVTHDVLPA
IRATGRYESVPAVPQSYADALQLAADQARQLDAQAAELAEAAPKAASWDTLASAEGDWSV
RDAAKVLSRDPGLDLGERRLFTVLGEQQWIYRQRADGRWRPYQRAIESGWLSELPSTHYH
PRTGELVLDTPQVRVTTRGLHLLHRRLGGTQPLRTHEQTALIQ

MD5 = 4cf79997004e9a2a812230d8af777c76


  DNA Sequence

>fig|391037.3.peg.3648 Phage antirepressor protein
atgactcatccccaaggccccgccggacctggacctggcggcaccaccggtcccggccgc
gagatcacaacctttgaattcggcgatctcccgttgcggacggtcacggttggcaatgag
ccgtggttcgtcgctgtcgacgtgtgtagggcactggagatcggcaacccgcgccaagcg
gtgagctacctcgacgacgatgaggtgcggcaggcacccgtcactactgatgacgggtcg
gaccgggtgctcatgacgaacgtcgtcagcgaggccgggctgtactcactgattctccgt
agtcgcaagccggaggcgaaggcgttcaagcgctgggtgacccacgacgtgttgcccgcg
attcgggcgacgggccggtacgagtcggtgccggcggtgccgcagtcgtacgcggatgcg
ttgcagcttgccgcggatcaggcccggcagcttgacgcgcaggccgccgagttggcggag
gccgcgccgaaggcggcgtcgtgggacaccctcgcctcggcggagggcgactggtccgtg
cgggacgccgccaaggtgctatcgcgcgatccgggtctggacctcggggagcgacgcctg
ttcacggttctcggcgagcagcagtggatctatcggcagcgtgctgacggtcgttggcgg
ccgtaccagcgggcgatcgagtcgggctggctgtcggagctgccctcgacgcactaccac
ccgcgcaccggtgagctggtgctcgatacgcctcaggtgcgggtcaccacccggggcctg
catctgctgcaccgccggcttggcggtacgcagccgttgcggacgcatgagcagacggcg
ctgatccagtga


  DNA with Flanking Sequence

>fig|391037.3.peg.3648 Phage antirepressor protein
gacggtgtaggggatggggatgctgccacgaggtcaccgtaggtgccattcgcgggcctg
ttatctcgtggacggcagcgatgccgtggacggttgcggtgacgtgcgccgatagtgcgc
ggtctcagctggaggactcttggtcctgcacggctatgcatggcttacagggtagctctg
gtggccaggtgcagaatcatccgaacggccgatgtgatgctatgcgtggcattgcgatac
ggtagtgccatgcatggcaacgcatcacacagcaatgctgcgagtggcactgaatcggag
cagatcgcctacaaggtgccgcgtgcagctgagctcttggacctgggcccgcggaccgtc
tggcaactcgtcaaggacgaggaagacgaacccggtactggcatcgagtcgatcaaggtc
ggttggtcccgacgcgtgccccgtactgccctcctcgcctttatggaacggaagcgtgcc
cagggtcgggcggtgtccgaatgactcatccccaaggccccgccggacctggacctggcg
gcaccaccggtcccggccgcgagatcacaacctttgaattcggcgatctcccgttgcgga
cggtcacggttggcaatgagccgtggttcgtcgctgtcgacgtgtgtagggcactggaga
tcggcaacccgcgccaagcggtgagctacctcgacgacgatgaggtgcggcaggcacccg
tcactactgatgacgggtcggaccgggtgctcatgacgaacgtcgtcagcgaggccgggc
tgtactcactgattctccgtagtcgcaagccggaggcgaaggcgttcaagcgctgggtga
cccacgacgtgttgcccgcgattcgggcgacgggccggtacgagtcggtgccggcggtgc
cgcagtcgtacgcggatgcgttgcagcttgccgcggatcaggcccggcagcttgacgcgc
aggccgccgagttggcggaggccgcgccgaaggcggcgtcgtgggacaccctcgcctcgg
cggagggcgactggtccgtgcgggacgccgccaaggtgctatcgcgcgatccgggtctgg
acctcggggagcgacgcctgttcacggttctcggcgagcagcagtggatctatcggcagc
gtgctgacggtcgttggcggccgtaccagcgggcgatcgagtcgggctggctgtcggagc
tgccctcgacgcactaccacccgcgcaccggtgagctggtgctcgatacgcctcaggtgc
gggtcaccacccggggcctgcatctgctgcaccgccggcttggcggtacgcagccgttgc
ggacgcatgagcagacggcgctgatccagtgaccgccgccgctctgctggcccgcgcggt
cgcccagatcgtgaccggtttggcgctggtcgccgctggtctcaccgcgccaccggtgcc
gccggccccggcctcggactcgagtcccggcctggagtggcgttccgccaccgacgccga
gaggcgggagtggcagcgacagcgcctgttcgacctcatcgacgcgaagcggtcgatgaa
gtgagccccccgccgatctgcggtcggcgaagggctcgacacccggaccagaacctgatc
aaccaaggagtccagatgcaatcgcagagtaacccaaccactgagcggccagtctgcgcc
gccgcccaggccgacgctgagccggccacgccgcacctggccgagccgggctacatgtcc
tgcccgcgtgagtgcggggtggacgtgcgcgagcacaactcgtccggcctgatcgatggc
cggtgcgacacggactactggctggccctcgctgccgacctgcgtgcggtgg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
fig|391037.3.peg.3597 Salinispora arenicola CNS-205 FIG   Phage antirepressor protein
gb|ABV99533.1 Salinispora arenicola CNS-205     prophage antirepressor
gb|ABV99584.1 Salinispora arenicola CNS-205     prophage antirepressor
gi|157918106 Salinispora arenicola CNS-205 NCBI   prophage antirepressor
gi|157918157 Salinispora arenicola CNS-205 NCBI   prophage antirepressor
gi|159039271 Salinispora arenicola CNS-205 NCBI   prophage antirepressor
gi|159039322 Salinispora arenicola CNS-205 NCBI   prophage antirepressor
img|640042549 Salinispora arenicola CNS205 IMG   BRO-like
img|641273160 Salinispora arenicola CNS-205 IMG   prophage antirepressor
img|641273211 Salinispora arenicola CNS-205 IMG   prophage antirepressor
kegg|saq:Sare_3740 Salinispora arenicola CNS-205 KEGG   prophage antirepressor
kegg|saq:Sare_3791 Salinispora arenicola CNS-205 KEGG   prophage antirepressor
ref|YP_001538524.1 Salinispora arenicola CNS-205 RefSeq   prophage antirepressor
ref|YP_001538575.1 Salinispora arenicola CNS-205 RefSeq   prophage antirepressor
tr|A8M019 Salinispora arenicola (strain CNS-205) TrEMBL   Prophage antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search