The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.9: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig DQ530362 from base 94 to 10423 (10330 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1 1299 94 1206 -       1: 2   Phage integrase protein_id|ABF73226.1, gene_name|int, gi|104641918
2 1410 1589 180 + 110         Phage excisionase protein_id|ABF73227.1, gi|104641919
3 2501 1569 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73228.1, gi|104641920
4 2997 2533 465 - 31         Phage protein protein_id|ABF73229.1, gi|104641921
5 3324 3010 315 - 12         Phage repressor protein cI protein_id|ABF73230.1, gi|104641922
6 3476 3712 237 + 151         Phage transcriptional regulator cro protein_id|ABF73231.1, gi|104641923
7 3726 3905 180 + 13         Phage protein protein_id|ABF73232.1, gi|104641924
8 4488 4006 483 - 100         ORF029 protein_id|ABF73233.1, gi|104641925
9 4548 5297 750 + 59         Phage antirepressor protein protein_id|ABF73234.1, gi|104641926
10 5313 5531 219 + 15         Phage phi 11 orf9 protein homolog protein_id|ABF73235.1, gi|104641927
11 5561 5824 264 + 29         Phage protein protein_id|ABF73236.1, gi|104641928
12 5836 5997 162 + 11         Phage phi 11 orf10a protein homolog protein_id|ABF73237.1, gi|104641929
13 6089 6349 261 + 91         Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930
14 6359 6580 222 + 9         Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.9 Phage antirepressor protein
MQALQTKSNIGEMFNIQEKENGEIAISARELYKALEVKKRFSAWAEINLKHFKENRDFTS
VLTSTVVNNGAVRQLEDYALTLDVAKHVAMMSGTEKGFDFREYFIQIEKAWNSPEMIMQR
ALKIANNTINQLETKIERDKPKIVFADAVATTKTSILVGELAKIIKQNGINIGQRRLFEW
LRQNGFLIKRKGVDYNMPTQYSMERELFEIKETSITHSDGHTSISKTPKVTGKGQQYFVN
KFLGEKQTT

MD5 = 4a7a76fe0a4b7246ae5836029c98d49a


  DNA Sequence

>fig|387910.2.peg.9 Phage antirepressor protein
atgcaagcattacaaacaaaatcgaacatcggagaaatgttcaatattcaagaaaaagaa
aatggagaaatcgcaataagtgcaagagagttatataaagctttggaagttaaaaagcgt
tttagcgcttgggcagaaattaacttgaagcatttcaaagaaaatagggattttacaagt
gtacttacaagtacggttgttaataacggagctgtaagacaactagaagattatgcttta
acacttgatgtagctaaacatgttgcgatgatgtcaggtacagaaaaaggttttgatttt
agagagtatttcatccaaattgaaaaagcatggaacagtccagaaatgattatgcaacgt
gctttaaaaattgctaacaacacaatcaatcaattagagacaaagattgaacgtgataaa
ccaaaaattgtatttgcagatgcagtagctactactaagacatcaattttagttggagag
ttagcaaagatcattaaacaaaacggtataaacatcgggcaacgcagattgtttgagtgg
ttacgtcaaaacggattccttattaaacgcaagggtgtggattataacatgcctacacag
tattcaatggaacgtgagttattcgaaattaaagaaacatcaatcacacattcggacggt
cacacatcaattagtaagacgccaaaagtaacaggtaaaggacaacaatactttgttaac
aagtttttaggagaaaaacaaacaacttaa


  DNA with Flanking Sequence

>fig|387910.2.peg.9 Phage antirepressor protein
tttaagtttgtttattcgttgattagaaacaatctttataaacgcaggttctaattcgaa
tttatataaaaactctgatgacgaattagctatcataacttctggtttatctaattgttt
atcgattggagcatgcaaataacttggattatatataccgagagatgaatattcatcaga
ttccaatactacgttaataggtgttaaaacatttttgtttttatctaaaaatattaattc
ttctaaagtatgagttctagacgagtcattagcgacgacaaaatttaattctacaaaatt
attttcatagtagaaattaagatcgctaataacaaaactgaacttattttgagaacgagt
ataaaaaattgagtatgcagatagacctaaagctagaaaagctacaacgtttgaaaacaa
agtagattgtatgaattccataagaataaccaccttaaatatttgataacaacattatac
acgaaaggagcataaatattatgcaagcattacaaacaaaatcgaacatcggagaaatgt
tcaatattcaagaaaaagaaaatggagaaatcgcaataagtgcaagagagttatataaag
ctttggaagttaaaaagcgttttagcgcttgggcagaaattaacttgaagcatttcaaag
aaaatagggattttacaagtgtacttacaagtacggttgttaataacggagctgtaagac
aactagaagattatgctttaacacttgatgtagctaaacatgttgcgatgatgtcaggta
cagaaaaaggttttgattttagagagtatttcatccaaattgaaaaagcatggaacagtc
cagaaatgattatgcaacgtgctttaaaaattgctaacaacacaatcaatcaattagaga
caaagattgaacgtgataaaccaaaaattgtatttgcagatgcagtagctactactaaga
catcaattttagttggagagttagcaaagatcattaaacaaaacggtataaacatcgggc
aacgcagattgtttgagtggttacgtcaaaacggattccttattaaacgcaagggtgtgg
attataacatgcctacacagtattcaatggaacgtgagttattcgaaattaaagaaacat
caatcacacattcggacggtcacacatcaattagtaagacgccaaaagtaacaggtaaag
gacaacaatactttgttaacaagtttttaggagaaaaacaaacaacttaataggaggaat
tacaaatgaacgcactatacaaaacaaccctcctcatcacaatggcagttgtgacgtgga
aggtttggaagattgagaagcacactagaaaacctgtgattagtagcagggcgttgagtg
actatctaaacaacaaatctttaaccataccgaaagatgctgaaaattctactgaatctg
ctcgtcgccttttgaagttcgccgaacaaactattagcaaataacaacattatacacgaa
aggaaagatagaaatgccaaaaatcatagtaccaccaacaccagaaaacacatatagagg
cgaagaaaaatttgtgaaaaagttatacgcaacacctacacaaatccatcaattgtttgg
agtatgtagaagtacagtatacaactggttgaaatattaccgcaaagataatttaggtgt
agaaaatttatacattgattattcaccaacaggcactctgattaatatttctaaattgga
agagtatttg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
dbj|BAF66540.1 Staphylococcus aureus subsp. aureus str. Newman     phage anti-repressor protein
fig|426430.6.peg.271 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage antirepressor protein
fig|426430.8.peg.289 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage antirepressor protein
gb|ABF73234.1 Staphylococcus aureus phage phiNM4     antirepressor
gi|104641926 Staphylococcus aureus phage phiNM4 NCBI   antirepressor
gi|150373280 Staphylococcus aureus subsp. aureus str. Newman NCBI   phage anti-repressor protein
gi|151220480 Staphylococcus aureus subsp. aureus str. Newman NCBI   phage anti-repressor protein
img|640794628 Staphylococcus aureus aureus Newman IMG   phage anti-repressor protein
kegg|sae:NWMN_0268 Staphylococcus aureus subsp. aureus Newman KEGG   phage anti-repressor protein
ref|YP_001331302.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   phage anti-repressor protein
tr|A0EX25 Staphylococcus aureus phage phiNM4 TrEMBL   Antirepressor
tr|A6QDV8 Staphylococcus aureus (strain Newman) TrEMBL   Phage anti-repressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search