The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.37: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage protein
Translate Function Assignments



Context on contig DQ530362 from base 10433 to 21384 (10952 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
20 10433 11212 780 +           Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942
26 12560 12814 255 + -1         Phage protein protein_id|ABF73251.1, gi|104641943
27 12820 13062 243 + 5         Phage phi 11 orf22 protein homolog protein_id|ABF73252.1, gi|104641944
28 13077 13478 402 + 14         Phage protein protein_id|ABF73253.1, gi|104641945
29 13475 13669 195 + -4         Phage protein protein_id|ABF73254.1, gi|104641946
30 13666 14115 450 + -4         Phage protein protein_id|ABF73255.1, gi|104641947
31 14112 14396 285 + -4         Phage protein protein_id|ABF73256.1, gi|104641948
32 14389 14637 249 + -8         Phage phi 11 orf23 protein homolog protein_id|ABF73257.1, gi|104641949
33 14630 15166 537 + -8     1: 3   Phage dimeric dUTPase (EC 3.6.1.23) protein_id|ABF73258.1, gi|104641950
34 15203 15409 207 + 36         Phage phi 11 orf26a protein homolog protein_id|ABF73259.1, gi|104641951
35 15406 15600 195 + -4         Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73260.1, gi|104641952
36 15597 15800 204 + -4         Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73261.1, gi|104641953
37 15793 16029 237 + -8         Phage protein protein_id|ABF73262.1, gi|104641954
38 16022 16408 387 + -8         Hypothetical protein, SAV0881 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73263.1, gi|104641955
39 16405 16578 174 + -4         Phage integrase regulator RinB protein_id|ABF73264.1, gene_name|rinB, gi|104641956
40 16579 16980 402 + 0         Phage integrase regulator RinA protein_id|ABF73265.1, gi|104641957
41 17364 17825 462 + 383         Phage terminase, small subunit protein_id|ABF73266.1, gi|104641958
42 17818 19041 1224 + -8     2: 2 1   Phage terminase, large subunit protein_id|ABF73267.1, gi|104641959
43 19038 20462 1425 + -4     2: 2 1   Phage portal (connector) protein protein_id|ABF73268.1, gi|104641960
44 20431 21384 954 + -32     1: 1 isu Phage minor capsid protein protein_id|ABF73269.1, gi|104641961

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.37 Phage protein
MINIPKMKFPKKYTEIIKKYKNKTPEEKAKIEDDFIKEINDKDSEFYSPMMANMNEHELR
AMLRMMPSLIDTGDGNDD

MD5 = d90ae8774625d79aae1f4bdf3a1d4b3d


  DNA Sequence

>fig|387910.2.peg.37 Phage protein
atgattaacatacctaaaatgaaattcccgaaaaagtacactgaaataatcaaaaaatat
aaaaataaaacacctgaagaaaaagctaagattgaagatgatttcattaaagaaattaat
gataaagacagtgaattttacagtcctatgatggctaatatgaatgaacatgaattaagg
gctatgttaagaatgatgcctagtttaattgatactggagatggcaatgatgattaa


  DNA with Flanking Sequence

>fig|387910.2.peg.37 Phage protein
gtcgttgaggcagagagtaaagaagaagcgaaagagaagtacgaggcacaagttaaaaga
gatgcagttattaaagtgggtcagttgtatgaaaatataagggagtgtgggaaatgacgg
atgttaaaattaaaactatttcaggtggagtttattttgtaaaaacagctgaaccttttg
aaaaatatgttgaaagaatgacgagttttaatggttatatttacgcaagtactataatca
agaaaccaacgtatattaaaacagatacgattgaatcaatcacacttattgaggagcatg
ggaaatgaatcagctgagaattttattacatgacggtagtagtttgatattacatgaaga
tgaattatttaacgaaatagtatttgttttggacaattttagaaatgatgatgactattt
aacgatagaaaaagattatggcagagaacttgtattgaacaaaggttatatagttgggat
caatgttgaggaggcagatgatgattaacatacctaaaatgaaattcccgaaaaagtaca
ctgaaataatcaaaaaatataaaaataaaacacctgaagaaaaagctaagattgaagatg
atttcattaaagaaattaatgataaagacagtgaattttacagtcctatgatggctaata
tgaatgaacatgaattaagggctatgttaagaatgatgcctagtttaattgatactggag
atggcaatgatgattaaaaaacttaaaaatatggattggttcgatatctttattgctgga
atactgcgattattcggcgtaatcgcactgatgcttgttgtcatatcgcctatatacaca
gtggctagttaccaacacaaagaagtacatcaagggacaattacagataaatataacaag
agacaagataaagaagacaagttctatattgtattagacaacaaacaagtcattgaaaat
tctgatttattattcaaaaagaaatttgatagcgcagacatacaagctaggttaaaagta
ggcgataaagtaaaagttaagacgattggatatagaatacactttttaaatttatatccg
atcttatacgaagtaaagaaggtagataaaaaatgattaaacaaatattaagactattat
tcttactagcaatgtatgagctaggtaagtatgtaactgagcaagtatatattatgatga
cggctaatgatgatgtagaggcgccgagtgacttcgc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAF66557.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|320842.3.peg.50 Bacteriophage 96 FIG   Phage protein
fig|320848.3.peg.69 Bacteriophage 88 FIG   Phage protein
fig|320849.3.peg.71 Bacteriophage 92 FIG   Phage protein
fig|426430.6.peg.290 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage protein
fig|426430.8.peg.314 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage protein
fig|553568.3.peg.1176 Staphylococcus aureus A6224 FIG   Phage protein
fig|553577.3.peg.2929 Staphylococcus aureus A8796 FIG   Phage protein
fig|553580.3.peg.2707 Staphylococcus aureus A8819 FIG   Phage protein
gb|AAX91472.1 Bacteriophage 96     ORF062
gb|AAX91915.1 Bacteriophage 88     ORF065
gb|AAX91988.1 Bacteriophage 92     ORF068
gb|ABF73262.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gb|EEV80777.1 Staphylococcus aureus A6224     conserved hypothetical protein
gi|104641954 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|150373297 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220497 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0285
gi|257857886 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258448849 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|62636361 Bacteriophage 96 NCBI   ORF062
gi|62636804 Bacteriophage 88 NCBI   ORF065
gi|62636877 Bacteriophage 92 NCBI   ORF068
gi|66395940 Staphylococcus phage 96 NCBI   ORF062
gi|66396389 Staphylococcus phage 88 NCBI   ORF065
gi|66396463 Staphylococcus phage 92 NCBI   ORF068
img|638314721 Bacteriophage 96 IMG   ORF062
img|638315156 Bacteriophage 88 IMG   ORF065
img|638315230 Bacteriophage 92 IMG   ORF068
img|640794645 Staphylococcus aureus aureus Newman IMG   hypothetical protein
kegg|sae:NWMN_0285 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
ref|YP_001331319.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0285
ref|YP_240302.1 Staphylococcus phage 96 RefSeq   ORF062
ref|YP_240737.1 Staphylococcus phage 88 RefSeq   ORF065
ref|YP_240811.1 Staphylococcus phage 92 RefSeq   ORF068
ref|ZP_05696959.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
tr|A0EX53 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|A6QDX5 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|Q4ZAB5 Staphylococcus phage 92 TrEMBL   ORF068
tr|Q4ZAI9 Staphylococcus phage 88 TrEMBL   ORF065
tr|Q4ZBS4 Staphylococcus phage 96 TrEMBL   ORF062


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search