The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.36: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
Translate Function Assignments



Context on contig DQ530362 from base 10433 to 21384 (10952 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
20 10433 11212 780 +           Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942
26 12560 12814 255 + -1         Phage protein protein_id|ABF73251.1, gi|104641943
27 12820 13062 243 + 5         Phage phi 11 orf22 protein homolog protein_id|ABF73252.1, gi|104641944
28 13077 13478 402 + 14         Phage protein protein_id|ABF73253.1, gi|104641945
29 13475 13669 195 + -4         Phage protein protein_id|ABF73254.1, gi|104641946
30 13666 14115 450 + -4         Phage protein protein_id|ABF73255.1, gi|104641947
31 14112 14396 285 + -4         Phage protein protein_id|ABF73256.1, gi|104641948
32 14389 14637 249 + -8         Phage phi 11 orf23 protein homolog protein_id|ABF73257.1, gi|104641949
33 14630 15166 537 + -8     1: 3   Phage dimeric dUTPase (EC 3.6.1.23) protein_id|ABF73258.1, gi|104641950
34 15203 15409 207 + 36         Phage phi 11 orf26a protein homolog protein_id|ABF73259.1, gi|104641951
35 15406 15600 195 + -4         Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73260.1, gi|104641952
36 15597 15800 204 + -4         Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73261.1, gi|104641953
37 15793 16029 237 + -8         Phage protein protein_id|ABF73262.1, gi|104641954
38 16022 16408 387 + -8         Hypothetical protein, SAV0881 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73263.1, gi|104641955
39 16405 16578 174 + -4         Phage integrase regulator RinB protein_id|ABF73264.1, gene_name|rinB, gi|104641956
40 16579 16980 402 + 0         Phage integrase regulator RinA protein_id|ABF73265.1, gi|104641957
41 17364 17825 462 + 383         Phage terminase, small subunit protein_id|ABF73266.1, gi|104641958
42 17818 19041 1224 + -8     2: 2 1   Phage terminase, large subunit protein_id|ABF73267.1, gi|104641959
43 19038 20462 1425 + -4     2: 2 1   Phage portal (connector) protein protein_id|ABF73268.1, gi|104641960
44 20431 21384 954 + -32     1: 1 isu Phage minor capsid protein protein_id|ABF73269.1, gi|104641961

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.36 Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
MNQLRILLHDGSSLILHEDELFNEIVFVLDNFRNDDDYLTIEKDYGRELVLNKGYIVGIN
VEEADDD

MD5 = 8562c709e473e5af621c7c2ff62a9395


  DNA Sequence

>fig|387910.2.peg.36 Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
atgaatcagctgagaattttattacatgacggtagtagtttgatattacatgaagatgaa
ttatttaacgaaatagtatttgttttggacaattttagaaatgatgatgactatttaacg
atagaaaaagattatggcagagaacttgtattgaacaaaggttatatagttgggatcaat
gttgaggaggcagatgatgattaa


  DNA with Flanking Sequence

>fig|387910.2.peg.36 Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
caaaaagaaaatgaaaaggaatcatgaaagacaagatggaacagcagacgcaggaaaagg
atacgtgtaaagacatattagatcgagtcaaggaggttttggggaagtgacacaatactt
agtcacaacattcaaagattcaacaggacgtaaacatacacacataactaaagctaagag
taatcaaaggtttacagtcgttgaggcagagagtaaagaagaagcgaaagagaagtacga
ggcacaagttaaaagagatgcagttattaaagtgggtcagttgtatgaaaatataaggga
gtgtgggaaatgacggatgttaaaattaaaactatttcaggtggagtttattttgtaaaa
acagctgaaccttttgaaaaatatgttgaaagaatgacgagttttaatggttatatttac
gcaagtactataatcaagaaaccaacgtatattaaaacagatacgattgaatcaatcaca
cttattgaggagcatgggaaatgaatcagctgagaattttattacatgacggtagtagtt
tgatattacatgaagatgaattatttaacgaaatagtatttgttttggacaattttagaa
atgatgatgactatttaacgatagaaaaagattatggcagagaacttgtattgaacaaag
gttatatagttgggatcaatgttgaggaggcagatgatgattaacatacctaaaatgaaa
ttcccgaaaaagtacactgaaataatcaaaaaatataaaaataaaacacctgaagaaaaa
gctaagattgaagatgatttcattaaagaaattaatgataaagacagtgaattttacagt
cctatgatggctaatatgaatgaacatgaattaagggctatgttaagaatgatgcctagt
ttaattgatactggagatggcaatgatgattaaaaaacttaaaaatatggattggttcga
tatctttattgctggaatactgcgattattcggcgtaatcgcactgatgcttgttgtcat
atcgcctatatacacagtggctagttaccaacacaaagaagtacatcaagggacaattac
agataaatataacaagagacaagataaagaagacaagttctatattgtattagacaacaa
acaagtcattgaaaattctgatttattattcaaaaagaaatttgatagcgcagacataca
agct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT02SA0872 Staphylococcus aureus Mu50     aminotransferase
cmr|SACOL0360 Staphylococcus aureus subsp. aureus COL     hypothetical protein
dbj|BAB57041.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAF77757.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.879 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|158878.14.peg.907 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|259901.1.peg.61 Bacteriophage 77 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|320834.3.peg.71 Bacteriophage 69 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|359786.13.peg.951 Staphylococcus aureus subsp. aureus JH9 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|359786.3.peg.2077 Staphylococcus aureus subsp. aureus JH9 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|359787.11.peg.935 Staphylococcus aureus subsp. aureus JH1 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|359787.3.peg.2470 Staphylococcus aureus subsp. aureus JH1 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|418127.4.peg.811 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|418127.6.peg.893 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|426430.6.peg.289 Staphylococcus aureus subsp. aureus str. Newman FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|426430.8.peg.313 Staphylococcus aureus subsp. aureus str. Newman FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|505321.3.peg.1226 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|553565.3.peg.618 Staphylococcus aureus A5937 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|553568.3.peg.1235 Staphylococcus aureus A6224 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|553577.3.peg.1385 Staphylococcus aureus A8796 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|553580.3.peg.1727 Staphylococcus aureus A8819 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|553588.3.peg.2423 Staphylococcus aureus A9719 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|553592.3.peg.2462 Staphylococcus aureus A9763 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|553596.3.peg.274 Staphylococcus aureus A9781 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|553601.3.peg.2472 Staphylococcus aureus A10102 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|585151.3.peg.1530 Staphylococcus aureus subsp. aureus C427 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|585155.3.peg.2582 Staphylococcus aureus subsp. aureus H19 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|585891.3.peg.906 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|703339.3.peg.852 Staphylococcus aureus 04-02981 FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|93062.19.peg.346 Staphylococcus aureus subsp. aureus COL FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
fig|93062.4.peg.819 Staphylococcus aureus subsp. aureus COL FIG   Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B]
gb|AAR87928.1 Bacteriophage 77     77ORF072
gb|AAW37567.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0360
gb|AAX90810.1 Bacteriophage 69     ORF071
gb|ABF73261.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gb|ABR51755.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EEV25737.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV63410.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66354.1 Staphylococcus aureus A9719     phage77_ORF072 protein
gb|EEV80701.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV86513.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|104641953 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|14246648 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|149945819 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150393367 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0899
gi|156721340 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979205 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0874
gi|15923869 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0879
gi|253315715 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_06146
gi|255005670 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_04345
gi|257787397 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257793425 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257838931 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257841920 Staphylococcus aureus A9719 NCBI   phage77_ORF072 protein
gi|257857809 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257863757 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258418138 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258422088 Staphylococcus aureus A9719 NCBI   phage77_ORF072 protein
gi|258448913 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258453892 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|40557272 Bacteriophage 77 NCBI   77ORF072
gi|41189571 Staphylococcus phage 77 NCBI   77ORF072
gi|57285473 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0360
gi|57651287 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0360
gi|62635699 Bacteriophage 69 NCBI   ORF071
gi|66395348 Staphylococcus phage 69 NCBI   ORF071
img|637099392 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637151135 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|638305539 Bacteriophage 77 IMG   77ORF072
img|638314054 Bacteriophage 69 IMG   ORF071
img|639108168 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640778986 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640903615 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sac:SACOL0360 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sah:SaurJH1_0899 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|sav:SAV0879   KEGG   hypothetical protein
kegg|saw:SAHV_0874 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371403.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0879
ref|NP_958662.1 Staphylococcus phage 77 RefSeq   77ORF072
ref|YP_001316042.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0899
ref|YP_001441464.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0874
ref|YP_185252.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0360
ref|YP_239635.1 Staphylococcus phage 69 RefSeq   ORF071
ref|ZP_04838928.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_06146
ref|ZP_05144271.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_04345
ref|ZP_05642404.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05682403.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05685003.1 Staphylococcus aureus A9719 RefSeq   phage77_ORF072 protein
ref|ZP_05697022.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05701864.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A0EX52 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|A6TZY7 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7X070 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q4ZDP1 Staphylococcus phage 69 TrEMBL   ORF071
tr|Q5HJ05 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6R821 Staphylococcus phage 77 TrEMBL   77ORF072
tr|Q931Z3 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search