The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on aspen.cels.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.35: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B]
Translate Function Assignments



Context on contig DQ530362 from base 9653 to 21384 (11732 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
19 9653 10423 771 +       1: 4   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942
26 12560 12814 255 + -1         Phage protein protein_id|ABF73251.1, gi|104641943
27 12820 13062 243 + 5         Phage phi 11 orf22 protein homolog protein_id|ABF73252.1, gi|104641944
28 13077 13478 402 + 14         Phage protein protein_id|ABF73253.1, gi|104641945
29 13475 13669 195 + -4         Phage protein protein_id|ABF73254.1, gi|104641946
30 13666 14115 450 + -4         Phage protein protein_id|ABF73255.1, gi|104641947
31 14112 14396 285 + -4         Phage protein protein_id|ABF73256.1, gi|104641948
32 14389 14637 249 + -8         Phage phi 11 orf23 protein homolog protein_id|ABF73257.1, gi|104641949
33 14630 15166 537 + -8     1: 3   Phage dimeric dUTPase (EC 3.6.1.23) protein_id|ABF73258.1, gi|104641950
34 15203 15409 207 + 36         Phage phi 11 orf26a protein homolog protein_id|ABF73259.1, gi|104641951
35 15406 15600 195 + -4         Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73260.1, gi|104641952
36 15597 15800 204 + -4         Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73261.1, gi|104641953
37 15793 16029 237 + -8         Phage protein protein_id|ABF73262.1, gi|104641954
38 16022 16408 387 + -8         Hypothetical protein, SAV0881 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73263.1, gi|104641955
39 16405 16578 174 + -4         Phage integrase regulator RinB protein_id|ABF73264.1, gene_name|rinB, gi|104641956
40 16579 16980 402 + 0         Phage integrase regulator RinA protein_id|ABF73265.1, gi|104641957
41 17364 17825 462 + 383         Phage terminase, small subunit protein_id|ABF73266.1, gi|104641958
42 17818 19041 1224 + -8     2: 2 1   Phage terminase, large subunit protein_id|ABF73267.1, gi|104641959
43 19038 20462 1425 + -4     2: 2 1   Phage portal (connector) protein protein_id|ABF73268.1, gi|104641960
44 20431 21384 954 + -32     1: 1 isu Phage minor capsid protein protein_id|ABF73269.1, gi|104641961

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.35 Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B]
MTDVKIKTISGGVYFVKTAEPFEKYVERMTSFNGYIYASTIIKKPTYIKTDTIESITLIE
EHGK

MD5 = 240a5a4074c499091b1df69430e8cfe5


  DNA Sequence

>fig|387910.2.peg.35 Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B]
atgacggatgttaaaattaaaactatttcaggtggagtttattttgtaaaaacagctgaa
ccttttgaaaaatatgttgaaagaatgacgagttttaatggttatatttacgcaagtact
ataatcaagaaaccaacgtatattaaaacagatacgattgaatcaatcacacttattgag
gagcatgggaaatga


  DNA with Flanking Sequence

>fig|387910.2.peg.35 Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B]
attgaatcaagttttaaagatacagaatttcacaaaatgtttaattttaaagataaagaa
tttgctcaagacgcagttgttagtacaccacagataatattcaaagaattttatcccgac
caacaagcaattgttatagtgatagacatagcttacaacttatattctatcgaccaactc
attgacgcatacaaaaagaaaatgaaaaggaatcatgaaagacaagatggaacagcagac
gcaggaaaaggatacgtgtaaagacatattagatcgagtcaaggaggttttggggaagtg
acacaatacttagtcacaacattcaaagattcaacaggacgtaaacatacacacataact
aaagctaagagtaatcaaaggtttacagtcgttgaggcagagagtaaagaagaagcgaaa
gagaagtacgaggcacaagttaaaagagatgcagttattaaagtgggtcagttgtatgaa
aatataagggagtgtgggaaatgacggatgttaaaattaaaactatttcaggtggagttt
attttgtaaaaacagctgaaccttttgaaaaatatgttgaaagaatgacgagttttaatg
gttatatttacgcaagtactataatcaagaaaccaacgtatattaaaacagatacgattg
aatcaatcacacttattgaggagcatgggaaatgaatcagctgagaattttattacatga
cggtagtagtttgatattacatgaagatgaattatttaacgaaatagtatttgttttgga
caattttagaaatgatgatgactatttaacgatagaaaaagattatggcagagaacttgt
attgaacaaaggttatatagttgggatcaatgttgaggaggcagatgatgattaacatac
ctaaaatgaaattcccgaaaaagtacactgaaataatcaaaaaatataaaaataaaacac
ctgaagaaaaagctaagattgaagatgatttcattaaagaaattaatgataaagacagtg
aattttacagtcctatgatggctaatatgaatgaacatgaattaagggctatgttaagaa
tgatgcctagtttaattgatactggagatggcaatgatgattaaaaaacttaaaaatatg
gattggttcgatatctttattgctggaatactgcgattattcggcgtaatcgcac


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search