The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.31: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage protein
Translate Function Assignments



Context on contig DQ530362 from base 8731 to 20462 (11732 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
18 9588 8731 858 -           Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 3   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942
26 12560 12814 255 + -1         Phage protein protein_id|ABF73251.1, gi|104641943
27 12820 13062 243 + 5         Phage phi 11 orf22 protein homolog protein_id|ABF73252.1, gi|104641944
28 13077 13478 402 + 14         Phage protein protein_id|ABF73253.1, gi|104641945
29 13475 13669 195 + -4         Phage protein protein_id|ABF73254.1, gi|104641946
30 13666 14115 450 + -4         Phage protein protein_id|ABF73255.1, gi|104641947
31 14112 14396 285 + -4         Phage protein protein_id|ABF73256.1, gi|104641948
32 14389 14637 249 + -8         Phage phi 11 orf23 protein homolog protein_id|ABF73257.1, gi|104641949
33 14630 15166 537 + -8     1: 4   Phage dimeric dUTPase (EC 3.6.1.23) protein_id|ABF73258.1, gi|104641950
34 15203 15409 207 + 36         Phage phi 11 orf26a protein homolog protein_id|ABF73259.1, gi|104641951
35 15406 15600 195 + -4         Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73260.1, gi|104641952
36 15597 15800 204 + -4         Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73261.1, gi|104641953
37 15793 16029 237 + -8         Phage protein protein_id|ABF73262.1, gi|104641954
38 16022 16408 387 + -8         Hypothetical protein, SAV0881 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73263.1, gi|104641955
39 16405 16578 174 + -4         Phage integrase regulator RinB protein_id|ABF73264.1, gene_name|rinB, gi|104641956
40 16579 16980 402 + 0         Phage integrase regulator RinA protein_id|ABF73265.1, gi|104641957
41 17364 17825 462 + 383         Phage terminase, small subunit protein_id|ABF73266.1, gi|104641958
42 17818 19041 1224 + -8     2: 1 2   Phage terminase, large subunit protein_id|ABF73267.1, gi|104641959
43 19038 20462 1425 + -4     2: 1 2   Phage portal (connector) protein protein_id|ABF73268.1, gi|104641960

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.31 Phage protein
MNYETGVQLGVMDARLKKMRKQRDEYKKQRDELIGDIGKLRERNKELEKKASAWDRYCKS
VEKDLINEFGKDGERVKFGMELNNKTFMEEDTNE

MD5 = f425ddb9f58addbc18e19208014770fe


  DNA Sequence

>fig|387910.2.peg.31 Phage protein
atgaactatgaaacaggggtccaactaggtgtaatggacgctaggttgaagaagatgaga
aaacaacgtgatgagtacaagaagcaacgtgatgagcttattggggatataggtaagtta
agagaacgcaacaaagagctggagaagaaagcaagtgcatgggataggtattgcaagagc
gttgaaaaagatttaataaacgaatttggcaaagatggtgaaagagttaaatttggaatg
gaattaaacaataaaacttttatggaggaagacactaatgaataa


  DNA with Flanking Sequence

>fig|387910.2.peg.31 Phage protein
aaagctcccgttccaaactgcaagcatagaggtcgaaaaagtggaggtagtagtatgatg
ccgaaatatcgagtgtgggacgaatatacaggaagaatacacgatgttgtaggattcgac
ttcattgagactgaagttcactatgaaaactacgcggaagcagaagctttaatacatgca
agagattttaaagatgtagaacttatgcaaagtacaggacttaaagacaaaaacaacaac
gaaatatatgcgggagatatagttgagtttgaagatgaaatattagagatgccagacgat
gaatctgtaataggaacaattaatagagcagtaatatctattgatgttgtaaatggtatt
caattaaaagattttatgtttgagggcgcagtctccgaaaatgattactttgagtatata
gacataaaatccttccttagatatgactgtgaggttaaaggcaacatatttgaatcatca
catttattggaggtaacagaatgaactatgaaacaggggtccaactaggtgtaatggacg
ctaggttgaagaagatgagaaaacaacgtgatgagtacaagaagcaacgtgatgagctta
ttggggatataggtaagttaagagaacgcaacaaagagctggagaagaaagcaagtgcat
gggataggtattgcaagagcgttgaaaaagatttaataaacgaatttggcaaagatggtg
aaagagttaaatttggaatggaattaaacaataaaacttttatggaggaagacactaatg
aataaccgtgaacaaatagaacaatccgttataagtgctagtgcgtataacggcaatgac
acagagggattactaaaagagattgaggacgtatataagaaagcgcaagcgtttgatgaa
atacttgagggaatgacaaatgctattcaacattcagttaaagaaggtattgaacttgat
gaagcagtagggattatgacgggtcaagttgtctataaatatgaggaggcacaggaaaat
gactaacacattaacaattgatcagttacaagagttattacaaatacaaaaggagttcga
cgatagaataccaacgctgaacttacgagatagcaaaatagcatatgtagttgaattctt
tgaatggtttaatacattggaaacgtttaagaactggaagaagaaaccaggtaagccgtt
agacgtacaacttgatgaattagctgacatgttggcgtttggattgagtattgcgaatca
agtaggagtgtcatcagaagagata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAF66555.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF67283.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF68069.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|387905.2.peg.29 Siphoviridae Staphylococcus phage phiNM FIG   Phage protein
fig|387908.2.peg.31 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Phage protein
fig|426430.6.peg.1741 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage protein
fig|426430.6.peg.284 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage protein
fig|426430.6.peg.983 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage protein
fig|426430.8.peg.1102 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage protein
fig|426430.8.peg.1945 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage protein
fig|426430.8.peg.308 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage protein
fig|585151.3.peg.1678 Staphylococcus aureus subsp. aureus C427 FIG   Phage protein
gb|ABF73059.1 Staphylococcus aureus phage phiNM1     hypothetical protein
gb|ABF73125.1 Staphylococcus aureus phage phiNM2     hypothetical protein
gb|ABF73256.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gi|104641645 Staphylococcus aureus phage phiNM1 NCBI   hypothetical protein
gi|104641747 Staphylococcus aureus phage phiNM2 NCBI   hypothetical protein
gi|104641948 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|118430753 Staphylococcus phage phiNM NCBI   hypothetical protein SAPPV1_gp29
gi|150373295 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150374023 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150374809 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220495 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0283
gi|151221223 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1011
gi|151222009 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1797
img|640794643 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640795391 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640796214 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641203584 Staphylococcus aureus phage phiNM provirus IMG   hypothetical protein
kegg|sae:NWMN_0283 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sae:NWMN_1011 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sae:NWMN_1797 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
ref|YP_001331317.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0283
ref|YP_001332045.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1011
ref|YP_001332831.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1797
ref|YP_873978.1 Staphylococcus phage phiNM RefSeq   hypothetical protein SAPPV1_gp29
tr|A0EWK0 Staphylococcus aureus phage phiNM1 TrEMBL   Putative uncharacterized protein
tr|A0EWR6 Staphylococcus aureus phage phiNM2 TrEMBL   Putative uncharacterized protein
tr|A0EX47 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|A6QDX3 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search