The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.23: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
Translate Function Assignments



Context on contig DQ530362 from base 6573 to 16980 (10408 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
15 6573 7361 789 +           Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942
26 12560 12814 255 + -1         Phage protein protein_id|ABF73251.1, gi|104641943
27 12820 13062 243 + 5         Phage phi 11 orf22 protein homolog protein_id|ABF73252.1, gi|104641944
28 13077 13478 402 + 14         Phage protein protein_id|ABF73253.1, gi|104641945
29 13475 13669 195 + -4         Phage protein protein_id|ABF73254.1, gi|104641946
30 13666 14115 450 + -4         Phage protein protein_id|ABF73255.1, gi|104641947
31 14112 14396 285 + -4         Phage protein protein_id|ABF73256.1, gi|104641948
32 14389 14637 249 + -8         Phage phi 11 orf23 protein homolog protein_id|ABF73257.1, gi|104641949
33 14630 15166 537 + -8     1: 2   Phage dimeric dUTPase (EC 3.6.1.23) protein_id|ABF73258.1, gi|104641950
34 15203 15409 207 + 36         Phage phi 11 orf26a protein homolog protein_id|ABF73259.1, gi|104641951
35 15406 15600 195 + -4         Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73260.1, gi|104641952
36 15597 15800 204 + -4         Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73261.1, gi|104641953
37 15793 16029 237 + -8         Phage protein protein_id|ABF73262.1, gi|104641954
38 16022 16408 387 + -8         Hypothetical protein, SAV0881 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73263.1, gi|104641955
39 16405 16578 174 + -4         Phage integrase regulator RinB protein_id|ABF73264.1, gene_name|rinB, gi|104641956
40 16579 16980 402 + 0         Phage integrase regulator RinA protein_id|ABF73265.1, gi|104641957

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.23 Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
MEIEIKFNETFEAPMGSPRPRFRNTGRFVQTYMPTAYTNHKAYIQGQMPKLNLERALKIE
LDFYFPLLKSWSKKKKSEMVGQYKVTKPDIDNLIKTVLDACNGHVWKDDNQITEITSSKR
YGLEPKIIMRVEEVI

MD5 = 62ef52b952afa4e0cad552bcc91dc3a7


  DNA Sequence

>fig|387910.2.peg.23 Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
atggaaatagaaattaaatttaacgaaacgttcgaggcacctatgggctcgcctcgtcca
cgctttcgtaatacaggtagatttgttcaaacatacatgccaacagcttatacaaatcat
aaagcgtatatacaagggcaaatgcctaagttaaatctagagcgcgcactaaaaatcgaa
ttagacttttactttccattacttaaatcatggtcgaagaaaaagaaaagtgaaatggtt
ggacagtataaagtgactaagccggatatcgataacttaattaaaacagtattagacgca
tgtaatggtcatgtgtggaaagacgataaccaaattacagaaataactagctcaaagcgt
tatggactagaaccaaaaataatcatgcgagttgaggaagtgatctaa


  DNA with Flanking Sequence

>fig|387910.2.peg.23 Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
ctaaatcaaaatatgaactggcaacgtatcaattcaagaatgaaacacaatgcgagaaaa
gtaagagtaatcggagacgatttcagggagcgagatgcatggtaaccaaagaatttttaa
aaactaaacttgagtgttcagatatgtacgctcagaaactcatagatgaggcacagggcg
atgaaaataggttgtacgacctatttatccaaaaacttgcagaacgtcatacacgccccg
ctatcgtcgaatattaaggagtgttaaaaatgccgaaagaaaaatattacttataccgag
aagatggcacggaagatattaaggtcatcaagtataaagacaacgtaaatgaagtttatt
cgctcacaggagcccatttcagcgacgaaaagaaaatcatggctgatagtgacctaaaac
gattcaaaggcgctcacgggcttttatatgagcaagagctagggttacaagcaacgatat
ttgatatttagaggtggcacatggaaatagaaattaaatttaacgaaacgttcgaggcac
ctatgggctcgcctcgtccacgctttcgtaatacaggtagatttgttcaaacatacatgc
caacagcttatacaaatcataaagcgtatatacaagggcaaatgcctaagttaaatctag
agcgcgcactaaaaatcgaattagacttttactttccattacttaaatcatggtcgaaga
aaaagaaaagtgaaatggttggacagtataaagtgactaagccggatatcgataacttaa
ttaaaacagtattagacgcatgtaatggtcatgtgtggaaagacgataaccaaattacag
aaataactagctcaaagcgttatggactagaaccaaaaataatcatgcgagttgaggaag
tgatctaatgcaacagcaagcatatataaacgcaacgattgatataaggatacctacaga
agttgaatatcagtattttgatgatgtggatatcgaaaaagaagcgctggcagattactt
atataacaatccagacgaattactagagtatgacaatttaaaaattagaaatgtaaatgt
agaggtggaataaatgagtgtcgtgaagattaacggtaaaccatataaatttaccgaaca
tgaaaatgaattgataaaaaagaacgggttaactcctggaatggttgcaaaaagagtacg
tggtggctgggcgttgttagaagccttaaacgcaccttatggcatgcgcttagctgagta
taaagaaatcgtattatccagaattatgcaacgagagagcaaagaacgtgaaatagctag
gcaacgacgtaaagaggttgaactacgtaagaggaaaccacatttgtttaatgtaccaca
aaaacattcacgtgatccgtactggttc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0000287       F:magnesium ion binding
GO:0006281       P:DNA repair
GO:0006310       P:DNA recombination
dbj|BAF66549.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF67277.1 Staphylococcus aureus subsp. aureus str. Newman     endodeoxyribonuclease
dbj|BAF68075.1 Staphylococcus aureus subsp. aureus str. Newman     phage endodeoxyribonuclease
fig|320835.3.peg.3 Bacteriophage 53 FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|320843.3.peg.17 Bacteriophage ROSA FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|387905.2.peg.21 Siphoviridae Staphylococcus phage phiNM FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|387908.2.peg.23 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|426430.6.peg.1747 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|426430.6.peg.278 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|426430.6.peg.977 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|426430.8.peg.1095 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|426430.8.peg.1952 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|426430.8.peg.301 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|53369.2.peg.24 Siphoviridae Staphylococcus phage 80alpha FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
fig|59506.3.peg.67 Bacteriophage 85 FIG   Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4)
gb|AAX90861.1 Bacteriophage 53     ORF033
gb|AAX90943.1 Bacteriophage 85     ORF037
gb|AAX91525.1 Bacteriophage ROSA     ORF030
gb|ABF71595.1 Staphylococcus phage 80alpha     RusA
gb|ABF73051.1 Staphylococcus aureus phage phiNM1     endodeoxyribonuclease RusA
gb|ABF73117.1 Staphylococcus aureus phage phiNM2     endodeoxyribonuclease RusA
gb|ABF73248.1 Staphylococcus aureus phage phiNM4     endodeoxyribonuclease RusA
gi|103058652 Staphylococcus phage 80alpha NCBI   RusA
gi|104641637 Staphylococcus aureus phage phiNM1 NCBI   endodeoxyribonuclease RusA
gi|104641739 Staphylococcus aureus phage phiNM2 NCBI   endodeoxyribonuclease RusA
gi|104641940 Staphylococcus aureus phage phiNM4 NCBI   endodeoxyribonuclease RusA
gi|118430745 Staphylococcus phage phiNM NCBI   endodeoxyribonuclease RusA
gi|148717866 Staphylococcus phage 80alpha NCBI   RusA
gi|150373289 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150374017 Staphylococcus aureus subsp. aureus str. Newman NCBI   endodeoxyribonuclease
gi|150374815 Staphylococcus aureus subsp. aureus str. Newman NCBI   phage endodeoxyribonuclease
gi|151220489 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0277
gi|151221217 Staphylococcus aureus subsp. aureus str. Newman NCBI   endodeoxyribonuclease
gi|151222015 Staphylococcus aureus subsp. aureus str. Newman NCBI   phage endodeoxyribonuclease
gi|62635750 Bacteriophage 53 NCBI   ORF033
gi|62635832 Bacteriophage 85 NCBI   ORF037
gi|62636414 Bacteriophage ROSA NCBI   ORF030
gi|66394903 Staphylococcus phage 85 NCBI   ORF037
gi|66395400 Staphylococcus phage 53 NCBI   ORF033
gi|66395994 Staphylococcus phage ROSA NCBI   ORF030
img|638314122 Bacteriophage 53 IMG   ORF033
img|638314205 Bacteriophage 85 IMG   ORF037
img|638314782 Bacteriophage ROSA IMG   ORF030
img|640794637 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640795385 Staphylococcus aureus aureus Newman IMG   endodeoxyribonuclease
img|640796220 Staphylococcus aureus aureus Newman IMG   phage endodeoxyribonuclease
img|641203576 Staphylococcus aureus phage phiNM provirus IMG   endodeoxyribonuclease RusA
img|641208687 Staphylococcus phage 80alpha IMG   RusA
kegg|sae:NWMN_0277 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sae:NWMN_1005 Staphylococcus aureus subsp. aureus Newman KEGG   endodeoxyribonuclease
kegg|sae:NWMN_1803 Staphylococcus aureus subsp. aureus Newman KEGG   phage endodeoxyribonuclease
ref|YP_001285338.1 Staphylococcus phage 80alpha RefSeq   RusA
ref|YP_001331311.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0277
ref|YP_001332039.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   endodeoxyribonuclease
ref|YP_001332837.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   phage endodeoxyribonuclease
ref|YP_239703.1 Staphylococcus phage 53 RefSeq   ORF033
ref|YP_239786.1 Staphylococcus phage 85 RefSeq   ORF037
ref|YP_240363.1 Staphylococcus phage ROSA RefSeq   ORF030
ref|YP_873970.1 Staphylococcus phage phiNM RefSeq   endodeoxyribonuclease RusA
tr|A0EWJ2 Staphylococcus aureus phage phiNM1 TrEMBL   Endodeoxyribonuclease RusA
tr|A0EWQ8 Staphylococcus aureus phage phiNM2 TrEMBL   Endodeoxyribonuclease RusA
tr|A0EX39 Staphylococcus aureus phage phiNM4 TrEMBL   Endodeoxyribonuclease RusA
tr|A4ZF90 Staphylococcus phage 80alpha TrEMBL   RusA
tr|A6QDW7 Staphylococcus aureus (strain Newman) TrEMBL   Endodeoxyribonuclease
tr|Q4ZBL3 Staphylococcus phage ROSA TrEMBL   ORF030
tr|Q4ZD90 Staphylococcus phage 85 TrEMBL   ORF037
tr|Q4ZDH3 Staphylococcus phage 53 TrEMBL   ORF033


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search