The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|387910.2.peg.22: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage phi 11 orf17 protein homolog
Translate Function Assignments


Context on contig DQ530362 from base 6359 to 16980 (10622 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
14 6359 6580 222 +           Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942
26 12560 12814 255 + -1         Phage protein protein_id|ABF73251.1, gi|104641943
27 12820 13062 243 + 5         Phage phi 11 orf22 protein homolog protein_id|ABF73252.1, gi|104641944
28 13077 13478 402 + 14         Phage protein protein_id|ABF73253.1, gi|104641945
29 13475 13669 195 + -4         Phage protein protein_id|ABF73254.1, gi|104641946
30 13666 14115 450 + -4         Phage protein protein_id|ABF73255.1, gi|104641947
31 14112 14396 285 + -4         Phage protein protein_id|ABF73256.1, gi|104641948
32 14389 14637 249 + -8         Phage phi 11 orf23 protein homolog protein_id|ABF73257.1, gi|104641949
33 14630 15166 537 + -8     1: 2   Phage dimeric dUTPase (EC 3.6.1.23) protein_id|ABF73258.1, gi|104641950
34 15203 15409 207 + 36         Phage phi 11 orf26a protein homolog protein_id|ABF73259.1, gi|104641951
35 15406 15600 195 + -4         Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73260.1, gi|104641952
36 15597 15800 204 + -4         Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73261.1, gi|104641953
37 15793 16029 237 + -8         Phage protein protein_id|ABF73262.1, gi|104641954
38 16022 16408 387 + -8         Hypothetical protein, SAV0881 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73263.1, gi|104641955
39 16405 16578 174 + -4         Phage integrase regulator RinB protein_id|ABF73264.1, gene_name|rinB, gi|104641956
40 16579 16980 402 + 0         Phage integrase regulator RinA protein_id|ABF73265.1, gi|104641957

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.22 Phage phi 11 orf17 protein homolog
MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMADSDLKRFKGAHGLLY
EQELGLQATIFDI

MD5 = b3e25e2dc9d31d844f18f26ba359614f


  DNA Sequence

>fig|387910.2.peg.22 Phage phi 11 orf17 protein homolog
atgccgaaagaaaaatattacttataccgagaagatggcacggaagatattaaggtcatc
aagtataaagacaacgtaaatgaagtttattcgctcacaggagcccatttcagcgacgaa
aagaaaatcatggctgatagtgacctaaaacgattcaaaggcgctcacgggcttttatat
gagcaagagctagggttacaagcaacgatatttgatatttag


  DNA with Flanking Sequence

>fig|387910.2.peg.22 Phage phi 11 orf17 protein homolog
gttgcttttatgcacataccaatgttgatggatcgtatcaaagcgacatacaacaaaaat
gcagtagagactacagacgagctagtcagattgctaagtgatattgatttacttgtacta
gatgatatgggtgtagaaaacacagagcacactttaaataaacttttcagcattgttgat
aacagagtaggtaaaaacaacatctttacaactaactttagtgataaagaactaaatcaa
aatatgaactggcaacgtatcaattcaagaatgaaacacaatgcgagaaaagtaagagta
atcggagacgatttcagggagcgagatgcatggtaaccaaagaatttttaaaaactaaac
ttgagtgttcagatatgtacgctcagaaactcatagatgaggcacagggcgatgaaaata
ggttgtacgacctatttatccaaaaacttgcagaacgtcatacacgccccgctatcgtcg
aatattaaggagtgttaaaaatgccgaaagaaaaatattacttataccgagaagatggca
cggaagatattaaggtcatcaagtataaagacaacgtaaatgaagtttattcgctcacag
gagcccatttcagcgacgaaaagaaaatcatggctgatagtgacctaaaacgattcaaag
gcgctcacgggcttttatatgagcaagagctagggttacaagcaacgatatttgatattt
agaggtggcacatggaaatagaaattaaatttaacgaaacgttcgaggcacctatgggct
cgcctcgtccacgctttcgtaatacaggtagatttgttcaaacatacatgccaacagctt
atacaaatcataaagcgtatatacaagggcaaatgcctaagttaaatctagagcgcgcac
taaaaatcgaattagacttttactttccattacttaaatcatggtcgaagaaaaagaaaa
gtgaaatggttggacagtataaagtgactaagccggatatcgataacttaattaaaacag
tattagacgcatgtaatggtcatgtgtggaaagacgataaccaaattacagaaataacta
gctcaaagcgttatggactagaaccaaaaataatcatgcgagttgaggaagtgatctaat
gcaacagcaagcatatataaacgcaacgattgatataaggatacctacagaagttgaata
tcagtattttgatgatgtggat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|320835.3.peg.2 Bacteriophage 53 FIG   Phage phi 11 orf17 protein homolog
fig|320843.3.peg.16 Bacteriophage ROSA FIG   Phage phi 11 orf17 protein homolog
fig|320844.3.peg.58 Bacteriophage 71 FIG   Phage phi 11 orf17 protein homolog
fig|387905.2.peg.20 Siphoviridae Staphylococcus phage phiNM FIG   Phage phi 11 orf17 protein homolog
fig|387908.2.peg.22 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Phage phi 11 orf17 protein homolog
fig|426430.8.peg.1094 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf17 protein homolog
fig|426430.8.peg.1953 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf17 protein homolog
fig|426430.8.peg.300 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf17 protein homolog
fig|59506.3.peg.66 Bacteriophage 85 FIG   Phage phi 11 orf17 protein homolog
gb|AAX90883.1 Bacteriophage 53     ORF066
gb|AAX90965.1 Bacteriophage 85     ORF069
gb|AAX91551.1 Bacteriophage ROSA     ORF068
gb|AAX91626.1 Bacteriophage 71     ORF069
gb|ABF73050.1 Staphylococcus aureus phage phiNM1     hypothetical protein
gb|ABF73116.1 Staphylococcus aureus phage phiNM2     hypothetical protein
gb|ABF73247.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gi|104641636 Staphylococcus aureus phage phiNM1 NCBI   hypothetical protein
gi|104641738 Staphylococcus aureus phage phiNM2 NCBI   hypothetical protein
gi|104641939 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|118430744 Staphylococcus phage phiNM NCBI   hypothetical protein SAPPV1_gp20
gi|62635772 Bacteriophage 53 NCBI   ORF066
gi|62635854 Bacteriophage 85 NCBI   ORF069
gi|62636440 Bacteriophage ROSA NCBI   ORF068
gi|62636515 Bacteriophage 71 NCBI   ORF069
gi|66394925 Staphylococcus phage 85 NCBI   ORF069
gi|66395422 Staphylococcus phage 53 NCBI   ORF066
gi|66396020 Staphylococcus phage ROSA NCBI   ORF068
gi|66396096 Staphylococcus phage 71 NCBI   ORF069
img|638314121 Bacteriophage 53 IMG   ORF066
img|638314204 Bacteriophage 85 IMG   ORF069
img|638314781 Bacteriophage ROSA IMG   ORF068
img|638314856 Bacteriophage 71 IMG   ORF069
img|641203575 Staphylococcus aureus phage phiNM provirus IMG   hypothetical protein
ref|YP_239702.1 Staphylococcus phage 53 RefSeq   ORF066
ref|YP_239785.1 Staphylococcus phage 85 RefSeq   ORF069
ref|YP_240362.1 Staphylococcus phage ROSA RefSeq   ORF068
ref|YP_240437.1 Staphylococcus phage 71 RefSeq   ORF069
ref|YP_873969.1 Staphylococcus phage phiNM RefSeq   hypothetical protein SAPPV1_gp20
tr|A0EWJ1 Staphylococcus aureus phage phiNM1 TrEMBL   Putative uncharacterized protein
tr|A0EWQ7 Staphylococcus aureus phage phiNM2 TrEMBL   Putative uncharacterized protein
tr|A0EX38 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|Q4ZBD9 Staphylococcus phage 71 TrEMBL   ORF069
tr|Q4ZBL4 Staphylococcus phage ROSA TrEMBL   ORF068
tr|Q4ZD91 Staphylococcus phage 85 TrEMBL   ORF069
tr|Q4ZDH4 Staphylococcus phage 53 TrEMBL   ORF066


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search