The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|387910.2.peg.21: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage protein
Translate Function Assignments


Context on contig DQ530362 from base 6089 to 16408 (10320 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
13 6089 6349 261 +           Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930
14 6359 6580 222 + 9         Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942
26 12560 12814 255 + -1         Phage protein protein_id|ABF73251.1, gi|104641943
27 12820 13062 243 + 5         Phage phi 11 orf22 protein homolog protein_id|ABF73252.1, gi|104641944
28 13077 13478 402 + 14         Phage protein protein_id|ABF73253.1, gi|104641945
29 13475 13669 195 + -4         Phage protein protein_id|ABF73254.1, gi|104641946
30 13666 14115 450 + -4         Phage protein protein_id|ABF73255.1, gi|104641947
31 14112 14396 285 + -4         Phage protein protein_id|ABF73256.1, gi|104641948
32 14389 14637 249 + -8         Phage phi 11 orf23 protein homolog protein_id|ABF73257.1, gi|104641949
33 14630 15166 537 + -8     1: 2   Phage dimeric dUTPase (EC 3.6.1.23) protein_id|ABF73258.1, gi|104641950
34 15203 15409 207 + 36         Phage phi 11 orf26a protein homolog protein_id|ABF73259.1, gi|104641951
35 15406 15600 195 + -4         Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73260.1, gi|104641952
36 15597 15800 204 + -4         Hypothetical protein, SAV0879 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73261.1, gi|104641953
37 15793 16029 237 + -8         Phage protein protein_id|ABF73262.1, gi|104641954
38 16022 16408 387 + -8         Hypothetical protein, SAV0881 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73263.1, gi|104641955

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.21 Phage protein
MVTKEFLKTKLECSDMYAQKLIDEAQGDENRLYDLFIQKLAERHTRPAIVEY

MD5 = 39a4858242fbd1b90ddec3e8b04dc48b


  DNA Sequence

>fig|387910.2.peg.21 Phage protein
atggtaaccaaagaatttttaaaaactaaacttgagtgttcagatatgtacgctcagaaa
ctcatagatgaggcacagggcgatgaaaataggttgtacgacctatttatccaaaaactt
gcagaacgtcatacacgccccgctatcgtcgaatattaa


  DNA with Flanking Sequence

>fig|387910.2.peg.21 Phage protein
tacaagccacaaaatgaaaaacaagtacacgctaaacaaacagcaatagagtacgtacaa
ggcttctctacaaaagaaccaaaatcattaatattgcaaggttcatacggaactggtaaa
agccacctagcatacgctatcgcaaaagcagtcaaagctaaagggcatacggttgctttt
atgcacataccaatgttgatggatcgtatcaaagcgacatacaacaaaaatgcagtagag
actacagacgagctagtcagattgctaagtgatattgatttacttgtactagatgatatg
ggtgtagaaaacacagagcacactttaaataaacttttcagcattgttgataacagagta
ggtaaaaacaacatctttacaactaactttagtgataaagaactaaatcaaaatatgaac
tggcaacgtatcaattcaagaatgaaacacaatgcgagaaaagtaagagtaatcggagac
gatttcagggagcgagatgcatggtaaccaaagaatttttaaaaactaaacttgagtgtt
cagatatgtacgctcagaaactcatagatgaggcacagggcgatgaaaataggttgtacg
acctatttatccaaaaacttgcagaacgtcatacacgccccgctatcgtcgaatattaag
gagtgttaaaaatgccgaaagaaaaatattacttataccgagaagatggcacggaagata
ttaaggtcatcaagtataaagacaacgtaaatgaagtttattcgctcacaggagcccatt
tcagcgacgaaaagaaaatcatggctgatagtgacctaaaacgattcaaaggcgctcacg
ggcttttatatgagcaagagctagggttacaagcaacgatatttgatatttagaggtggc
acatggaaatagaaattaaatttaacgaaacgttcgaggcacctatgggctcgcctcgtc
cacgctttcgtaatacaggtagatttgttcaaacatacatgccaacagcttatacaaatc
ataaagcgtatatacaagggcaaatgcctaagttaaatctagagcgcgcactaaaaatcg
aattagacttttactttccattacttaaatcatggtcgaagaaaaagaaaagtgaaatgg
ttggacagtataaagtgac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|259901.1.peg.45 Bacteriophage 77 FIG   Phage protein
fig|320833.3.peg.59 Bacteriophage 187 FIG   Phage protein
fig|320835.3.peg.1 Bacteriophage 53 FIG   Phage protein
fig|320843.3.peg.15 Bacteriophage ROSA FIG   Phage protein
fig|387908.2.peg.21 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Phage protein
fig|55511.2.peg.59 Siphoviridae Staphylococcus phage 187 FIG   Phage protein
fig|59506.3.peg.65 Bacteriophage 85 FIG   Phage protein
gb|AAR87935.1 Bacteriophage 77     77ORF104
gb|AAX90749.1 Bacteriophage 187     ORF108
gb|AAX90899.1 Bacteriophage 53     ORF108
gb|AAX90980.1 Bacteriophage 85     ORF108
gb|AAX91563.1 Bacteriophage ROSA     ORF117
gb|ABF73115.1 Staphylococcus aureus phage phiNM2     hypothetical protein
gb|ABF73246.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gi|104641737 Staphylococcus aureus phage phiNM2 NCBI   hypothetical protein
gi|104641938 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|40557279 Bacteriophage 77 NCBI   77ORF104
gi|41189578 Staphylococcus phage 77 NCBI   77ORF104
gi|62635638 Bacteriophage 187 NCBI   ORF108
gi|62635788 Bacteriophage 53 NCBI   ORF108
gi|62635869 Bacteriophage 85 NCBI   ORF108
gi|62636452 Bacteriophage ROSA NCBI   ORF117
gi|66394940 Staphylococcus phage 85 NCBI   ORF108
gi|66395286 Staphylococcus phage 187 NCBI   ORF108
gi|66395438 Staphylococcus phage 53 NCBI   ORF108
gi|66396032 Staphylococcus phage ROSA NCBI   ORF117
img|638305523 Bacteriophage 77 IMG   77ORF104
img|638313965 Bacteriophage 187 IMG   ORF108
img|638314120 Bacteriophage 53 IMG   ORF108
img|638314203 Bacteriophage 85 IMG   ORF108
img|638314780 Bacteriophage ROSA IMG   ORF117
ref|NP_958646.1 Staphylococcus phage 77 RefSeq   77ORF104
ref|YP_239546.1 Staphylococcus phage 187 RefSeq   ORF108
ref|YP_239701.1 Staphylococcus phage 53 RefSeq   ORF108
ref|YP_239784.1 Staphylococcus phage 85 RefSeq   ORF108
ref|YP_240361.1 Staphylococcus phage ROSA RefSeq   ORF117
tr|A0EWQ6 Staphylococcus aureus phage phiNM2 TrEMBL   Putative uncharacterized protein
tr|A0EX37 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|Q4ZBL5 Staphylococcus phage ROSA TrEMBL   ORF117
tr|Q4ZD92 Staphylococcus phage 85 TrEMBL   ORF108
tr|Q4ZDH5 Staphylococcus phage 53 TrEMBL   ORF108
tr|Q4ZDY0 Staphylococcus phage 187 TrEMBL   ORF108
tr|Q6R837 Staphylococcus phage 77 TrEMBL   77ORF104


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search