The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.2: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage excisionase
Translate Function Assignments



Context on contig DQ530362 from base 94 to 7361 (7268 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1 1299 94 1206 -       1: 1   Phage integrase protein_id|ABF73226.1, gene_name|int, gi|104641918
2 1410 1589 180 + 110         Phage excisionase protein_id|ABF73227.1, gi|104641919
3 2501 1569 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73228.1, gi|104641920
4 2997 2533 465 - 31         Phage protein protein_id|ABF73229.1, gi|104641921
5 3324 3010 315 - 12         Phage repressor protein cI protein_id|ABF73230.1, gi|104641922
6 3476 3712 237 + 151         Phage transcriptional regulator cro protein_id|ABF73231.1, gi|104641923
7 3726 3905 180 + 13         Phage protein protein_id|ABF73232.1, gi|104641924
8 4488 4006 483 - 100         ORF029 protein_id|ABF73233.1, gi|104641925
9 4548 5297 750 + 59         Phage antirepressor protein protein_id|ABF73234.1, gi|104641926
10 5313 5531 219 + 15         Phage phi 11 orf9 protein homolog protein_id|ABF73235.1, gi|104641927
11 5561 5824 264 + 29         Phage protein protein_id|ABF73236.1, gi|104641928
12 5836 5997 162 + 11         Phage phi 11 orf10a protein homolog protein_id|ABF73237.1, gi|104641929
13 6089 6349 261 + 91         Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930
14 6359 6580 222 + 9         Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.2 Phage excisionase
MCVKFTDAEIAYIKESVENYSSEFDIYDDEQELKLKIYEQIMLKIKSEYKDTYLFRLIN

MD5 = 7f0af1d16e70b3e1f2a879ebef2884ef


  DNA Sequence

>fig|387910.2.peg.2 Phage excisionase
atgtgtgtaaaatttactgacgcagaaatagcttatataaaagaatcagttgaaaattat
agtagtgaatttgatatttatgacgatgaacaagaacttaaattaaaaatttatgaacaa
attatgttaaaaatcaaatctgaatacaaggatacctatttattccgtcttattaattga


  DNA with Flanking Sequence

>fig|387910.2.peg.2 Phage excisionase
tgataattcgttaataaatgtttgcatgtactttgtatcaattttgtttaaaagtaaatt
ttgagaactgttctttttgatgtttttgattcttgttttcaaattatcaagcgtcgttac
tttaaagccagatgtttttatatgatattcaagccattcatctaataacgcgtgaaaagt
caaagtttttaattcgcttgacgacttgttgtttagtttttcttttattttttcttctaa
acgaaacattgcctctttttgcgattgctttgtattcttattcaagacaacacttacacg
tttccatttatctgtatacggatctttgtatttctcgtagtatctatacttcgtttcatt
gttcttatttttaaatttttcaaaccacattttacatccctcctcaaaattggcaaaaaa
taataagggtaggcgggctacccgtgattttagtactagctactaaatgtgatataataa
aataaaaagtaggtgatgaaatgtgtgtaaaatttactgacgcagaaatagcttatataa
aagaatcagttgaaaattatagtagtgaatttgatatttatgacgatgaacaagaactta
aattaaaaatttatgaacaaattatgttaaaaatcaaatctgaatacaaggatacctatt
tattccgtcttattaattgatttggtatattctcttaatattttttcgttttcatcaaca
atgtcttttagtgtgtttaaaagaaagtcacaatcacctttggctactgcaccagcttgt
gaatggttgattatgtttctcatactatacgcaatttctacccgttttttggttctataa
tttactttaccttctttagttaattctcctaataattttgtgtacatagttgaatcggtg
tctttatgtttgattttattaactttttttaatttgattaaaaacgtttctatagcaaca
gcaaaggttgctgcagctggcaaatacaattcccttttataagcttgtaatccttgttct
atttgataagaaaaagttatatcatcaacaatctctttcatactatttaaatctaagtgg
ttgaacggttgtatttcatcatgtgctttgtttatcaatctttctttcgacttcgatatc
aatgtattgtaatgatcgttagctaatcttttgccataat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0006310       P:DNA recombination
fig|320835.3.peg.59 Bacteriophage 53 FIG   Phage excisionase
fig|320843.3.peg.65 Bacteriophage ROSA FIG   Phage excisionase
fig|320846.3.peg.39 Bacteriophage 29 FIG   Phage excisionase
fig|359786.13.peg.350 Staphylococcus aureus subsp. aureus JH9 FIG   Phage excisionase
fig|359786.3.peg.1030 Staphylococcus aureus subsp. aureus JH9 FIG   Phage excisionase
fig|359787.11.peg.348 Staphylococcus aureus subsp. aureus JH1 FIG   Phage excisionase
fig|359787.3.peg.2095 Staphylococcus aureus subsp. aureus JH1 FIG   Phage excisionase
fig|387905.2.peg.2 Siphoviridae Staphylococcus phage phiNM FIG   Phage excisionase
fig|426430.6.peg.1761 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage excisionase
fig|426430.6.peg.265 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage excisionase
fig|426430.8.peg.1971 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage excisionase
fig|426430.8.peg.282 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage excisionase
fig|548470.3.peg.1914 Staphylococcus aureus subsp. aureus MN8 FIG   Phage excisionase
fig|553568.3.peg.956 Staphylococcus aureus A6224 FIG   Phage excisionase
fig|553571.3.peg.2225 Staphylococcus aureus A6300 FIG   Phage excisionase
fig|585150.3.peg.2477 Staphylococcus aureus subsp. aureus C160 FIG   Phage excisionase
fig|585151.3.peg.1563 Staphylococcus aureus subsp. aureus C427 FIG   Phage excisionase
fig|585153.3.peg.2144 Staphylococcus aureus subsp. aureus E1410 FIG   Phage excisionase
fig|585155.3.peg.2462 Staphylococcus aureus subsp. aureus H19 FIG   Phage excisionase
fig|680649.3.peg.2628 Staphylococcus aureus subsp. aureus MR1 FIG   Phage excisionase
gb|AAA98160.1 Staphylococcus phage L54a     integrase
gb|AAX90894.1 Bacteriophage 53     ORF089
gb|AAX91558.1 Bacteriophage ROSA     ORF098
gb|AAX91784.1 Bacteriophage 29     ORF086
gb|ABF73032.1 Staphylococcus aureus phage phiNM1     excisionase
gb|ABF73227.1 Staphylococcus aureus phage phiNM4     excisionase
gb|ABQ48112.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0305
gb|ABR51174.1 Staphylococcus aureus subsp. aureus JH1     excisionase
gb|EEI95839.1 Staphylococcus aureus subsp. aureus MN8     conserved hypothetical protein
gb|EEV11411.1 Staphylococcus aureus subsp. aureus E1410     integrase
gb|EEV77147.1 Staphylococcus aureus A6300     excisionase
gb|EEV81158.1 Staphylococcus aureus A6224     excisionase
gi|104641618 Staphylococcus aureus phage phiNM1 NCBI   excisionase
gi|104641919 Staphylococcus aureus phage phiNM4 NCBI   excisionase
gi|118430726 Staphylococcus phage phiNM NCBI   excisionase
gi|139677 organism not parsed/found in ncbi nr NCBI   RecName: Full=Excisionase
gi|147739814 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0305
gi|148266745 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0305
gi|149945238 Staphylococcus aureus subsp. aureus JH1 NCBI   excisionase
gi|150392786 Staphylococcus aureus subsp. aureus JH1 NCBI   excisionase
gi|227246080 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227557519 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|257281274 Staphylococcus aureus subsp. aureus E1410 NCBI   integrase
gi|257433181 Staphylococcus aureus subsp. aureus E1410 NCBI   integrase
gi|257854194 Staphylococcus aureus A6300 NCBI   excisionase
gi|257858270 Staphylococcus aureus A6224 NCBI   excisionase
gi|258447181 Staphylococcus aureus A6300 NCBI   excisionase
gi|258448639 Staphylococcus aureus A6224 NCBI   excisionase
gi|455285 Staphylococcus phage L54a NCBI   integrase
gi|62635783 Bacteriophage 53 NCBI   ORF089
gi|62636447 Bacteriophage ROSA NCBI   ORF098
gi|62636673 Bacteriophage 29 NCBI   ORF086
gi|66395433 Staphylococcus phage 53 NCBI   ORF089
gi|66396027 Staphylococcus phage ROSA NCBI   ORF098
gi|66396256 Staphylococcus phage 29 NCBI   ORF086
gi|76011 organism not parsed/found in ncbi nr NCBI   integrase - Staphylococcus phage L54a
img|638314099 Bacteriophage 53 IMG   ORF089
img|638314755 Bacteriophage ROSA IMG   ORF098
img|638314986 Bacteriophage 29 IMG   ORF086
img|639108338 Staphylococcus aureus aureus JH1 IMG   excisionase
img|640564635 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778382 Staphylococcus aureus aureus JH1 IMG   excisionase
img|641203557 Staphylococcus aureus phage phiNM provirus IMG   excisionase
kegg|sah:SaurJH1_0312 Staphylococcus aureus subsp. aureus JH1 KEGG   excisionase
kegg|saj:SaurJH9_0305 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
pir| 1 PIR   (2'-5')oligo(A) synthetase (EC 2.7.7.-), splice form 8-2 - human
pir|RSBPL5 organism not parsed/found in ncbi nr PIR   integrase - Staphylococcus phage L54a
ref|YP_001245688.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0305
ref|YP_001315461.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   excisionase
ref|YP_239680.1 Staphylococcus phage 53 RefSeq   ORF089
ref|YP_240336.1 Staphylococcus phage ROSA RefSeq   ORF098
ref|YP_240567.1 Staphylococcus phage 29 RefSeq   ORF086
ref|YP_873951.1 Staphylococcus phage phiNM RefSeq   excisionase
ref|ZP_03987566.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   conserved hypothetical protein
ref|ZP_05609539.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   integrase
ref|ZP_05695331.1 Staphylococcus aureus A6300 RefSeq   excisionase
ref|ZP_05696752.1 Staphylococcus aureus A6224 RefSeq   excisionase
sp|P20710 Staphylococcus phage L54a (Bacteriophage L54a) SwissProt   Excisionase
sp|VXIS_BPL54 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Excisionase
tr|A0EWH3 Staphylococcus aureus phage phiNM1 TrEMBL   Excisionase
tr|A0EX18 Staphylococcus aureus phage phiNM4 TrEMBL   Excisionase
tr|A5IPI9 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6TYA6 Staphylococcus aureus (strain JH1) TrEMBL   Excisionase
tr|C2K626 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Putative uncharacterized protein
tr|Q4ZB09 Staphylococcus phage 29 TrEMBL   ORF086
tr|Q4ZBP0 Staphylococcus phage ROSA TrEMBL   ORF098
tr|Q4ZDJ6 Staphylococcus phage 53 TrEMBL   ORF089


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search