The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.17: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage phi 11 orf14 protein homolog
Translate Function Assignments



Context on contig DQ530362 from base 2533 to 13669 (11137 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4 2997 2533 465 -           Phage protein protein_id|ABF73229.1, gi|104641921
5 3324 3010 315 - 12         Phage repressor protein cI protein_id|ABF73230.1, gi|104641922
6 3476 3712 237 + 151         Phage transcriptional regulator cro protein_id|ABF73231.1, gi|104641923
7 3726 3905 180 + 13         Phage protein protein_id|ABF73232.1, gi|104641924
8 4488 4006 483 - 100         ORF029 protein_id|ABF73233.1, gi|104641925
9 4548 5297 750 + 59         Phage antirepressor protein protein_id|ABF73234.1, gi|104641926
10 5313 5531 219 + 15         Phage phi 11 orf9 protein homolog protein_id|ABF73235.1, gi|104641927
11 5561 5824 264 + 29         Phage protein protein_id|ABF73236.1, gi|104641928
12 5836 5997 162 + 11         Phage phi 11 orf10a protein homolog protein_id|ABF73237.1, gi|104641929
13 6089 6349 261 + 91         Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930
14 6359 6580 222 + 9         Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942
26 12560 12814 255 + -1         Phage protein protein_id|ABF73251.1, gi|104641943
27 12820 13062 243 + 5         Phage phi 11 orf22 protein homolog protein_id|ABF73252.1, gi|104641944
28 13077 13478 402 + 14         Phage protein protein_id|ABF73253.1, gi|104641945
29 13475 13669 195 + -4         Phage protein protein_id|ABF73254.1, gi|104641946

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.17 Phage phi 11 orf14 protein homolog
MQYITRYQKDNDGTYSVVATGVELEQSHIDLLENGYPLKAEVEVPDNKKLSIEQRKKIFA
MCRDIELHWGEPVESTRKLLQTELEIMKGYEEISLRDCSMKVARELIELIIAFMFHHQIP
MSVETSKLLSEDKALLYWATINRNCVICGKPHADLAHYEAVGRGMNRNKMNHYDKHVLAL
CREHHNEQHAIGVKSFDDKYHLHDSWIKVDERLNKMLKGEKKE

MD5 = d8103c2201b023f3f993bf5c4c1a3277


  DNA Sequence

>fig|387910.2.peg.17 Phage phi 11 orf14 protein homolog
atgcaatacattacaagataccagaaagataacgacggtacttattccgtcgttgctact
ggtgttgaacttgaacaaagtcacattgacttactagaaaacggatatccactaaaagca
gaagtagaggttccggacaataaaaaactatctatagaacaacgcaaaaaaatattcgca
atgtgtagagatatagaacttcactggggcgaaccagtagaatcaactagaaaattatta
caaacagaattggaaattatgaaaggttatgaagaaatcagtctgcgcgactgttctatg
aaagttgcaagggagttaatagaactgattatagcgtttatgtttcatcatcaaatacct
atgagtgtagaaacgagtaagttgttaagcgaagataaagcgttattatattgggctaca
atcaaccgcaactgtgtaatatgcggaaagcctcacgcagacctggcacattatgaagca
gtcggcagaggcatgaacagaaacaaaatgaaccactatgacaaacatgtattagcgtta
tgtcgcgaacatcacaacgagcaacatgcgattggcgttaagtcgtttgatgataaatac
cacttgcatgactcgtggataaaagttgatgagaggctcaataaaatgttgaaaggagag
aaaaaggaatga


  DNA with Flanking Sequence

>fig|387910.2.peg.17 Phage phi 11 orf14 protein homolog
cagcagggtttcaagctggagaattcacagtgaaagttaaaaatattgaattcaatgata
gagaaaatagatatttcacaatcgtatttgaaaatgatgaaggcaaacaatataaacata
atcaatttgtaccgccgtataaatatgatttccaagaaaaacaattgattgaattagtta
ctcgattaggtattaagttaaatcttcctagcttagattttgataccaatgatcttattg
gtaagttttgtcacttggtattgaaatggaaattcaatgaagatgaaggtaagtatttta
cggatttttcatttattaaaccttacaaaaagggcgatgatgttgttaacaaacctattc
cgaagacagataagcaaaaagctgaagaaaataacggggcacaacaacaaacatcaatgt
ctcaacaaagcaatccatttgaaagcagtggccaatttggatatgacgaccaagatttag
cgttttaaggtgtggtttaaatgcaatacattacaagataccagaaagataacgacggta
cttattccgtcgttgctactggtgttgaacttgaacaaagtcacattgacttactagaaa
acggatatccactaaaagcagaagtagaggttccggacaataaaaaactatctatagaac
aacgcaaaaaaatattcgcaatgtgtagagatatagaacttcactggggcgaaccagtag
aatcaactagaaaattattacaaacagaattggaaattatgaaaggttatgaagaaatca
gtctgcgcgactgttctatgaaagttgcaagggagttaatagaactgattatagcgttta
tgtttcatcatcaaatacctatgagtgtagaaacgagtaagttgttaagcgaagataaag
cgttattatattgggctacaatcaaccgcaactgtgtaatatgcggaaagcctcacgcag
acctggcacattatgaagcagtcggcagaggcatgaacagaaacaaaatgaaccactatg
acaaacatgtattagcgttatgtcgcgaacatcacaacgagcaacatgcgattggcgtta
agtcgtttgatgataaataccacttgcatgactcgtggataaaagttgatgagaggctca
ataaaatgttgaaaggagagaaaaaggaatgaatagactaagaataataaaaatagcact
cctaatcgtcatcttggcggaagagattagaaatgctatgcatgctgtaaaagtggagaa
aattttaaaatctccgtttagttaatacaggtttttacaaaagctttaccataggcggac
aaactaattgagccttttttgatgtctattacccaggggctgtaatgtaactttaatact
tcaaattcaatgccagaaagtttacttattgtttctaggttgtgtcctgactttaacatt
cttttaacaaattctaatcccgaaacaaatctttgtttttctataatcttattaaagtga
tttaaaaactgaggagcataaaacttattataaattcctttttttgttaagtaagacatg
tcaaaagtttcatttaaaacccctaaccttactaggttattaattgaaatttcggttgat
tctatatctaacggagagtcttttattaacgtgtccgatatattcataccgt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAF41169.1 Staphylococcus phage phiPVL108     hypothetical protein
dbj|BAF66545.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF67273.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF68079.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|259901.1.peg.40 Bacteriophage 77 FIG   Phage phi 11 orf14 protein homolog
fig|360398.2.peg.20 Staphylococcus phage FIG   Phage phi 11 orf14 protein homolog
fig|387905.2.peg.16 Siphoviridae Staphylococcus phage phiNM FIG   Phage phi 11 orf14 protein homolog
fig|387908.2.peg.16 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Phage phi 11 orf14 protein homolog
fig|405947.2.peg.15 Siphoviridae Staphylococcus phage 80 FIG   Phage phi 11 orf14 protein homolog
fig|426430.6.peg.1751 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf14 protein homolog
fig|426430.6.peg.274 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf14 protein homolog
fig|426430.6.peg.973 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf14 protein homolog
fig|426430.8.peg.1090 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf14 protein homolog
fig|426430.8.peg.1957 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf14 protein homolog
fig|426430.8.peg.296 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf14 protein homolog
fig|445517.2.peg.17 Viruses Staphylococcus phage tp310-3 Viruses. FIG   Phage phi 11 orf14 protein homolog
fig|585149.6.peg.1640 Staphylococcus aureus subsp. aureus C101 FIG   Phage phi 11 orf14 protein homolog
fig|585156.3.peg.1020 Staphylococcus aureus subsp. aureus M1015 FIG   Phage phi 11 orf14 protein homolog
fig|585159.3.peg.2058 Staphylococcus aureus subsp. aureus M899 FIG   Phage phi 11 orf14 protein homolog
fig|648017.2.peg.20 Viruses Staphylococcus phage phiPVL-CN125 Viruses. FIG   Phage phi 11 orf14 protein homolog
gb|AAR87890.1 Bacteriophage 77     77ORF018
gb|ABF73046.1 Staphylococcus aureus phage phiNM1     hypothetical protein
gb|ABF73110.1 Staphylococcus aureus phage phiNM2     hypothetical protein
gb|ABF73242.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gb|ABJ88863.1 Staphylococcus phage 80     conserved protein
gb|ABS87546.1 Staphylococcus phage tp310-3     hypothetical protein
gb|ACR54206.1 Staphylococcus phage phiPVL-CN125     hypothetical protein CUR017
gi|104641632 Staphylococcus aureus phage phiNM1 NCBI   hypothetical protein
gi|104641732 Staphylococcus aureus phage phiNM2 NCBI   hypothetical protein
gi|104641934 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|116235528 Staphylococcus phage 80 NCBI   conserved protein
gi|118430740 Staphylococcus phage phiNM NCBI   hypothetical protein SAPPV1_gp16
gi|119225798 Staphylococcus phage phiPVL108 NCBI   hypothetical protein
gi|119443672 Staphylococcus phage phiPVL108 NCBI   hypothetical protein SABPV108_gp20
gi|150373285 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150374013 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150374819 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220485 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0273
gi|151221213 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1001
gi|151222019 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1807
gi|154818120 Staphylococcus phage tp310-3 NCBI   hypothetical protein
gi|156604034 Staphylococcus phage tp310-3 NCBI   hypothetical protein SPTP3103_gp17
gi|238684003 Staphylococcus phage phiPVL-CN125 NCBI   hypothetical protein CUR017
gi|239507378 Staphylococcus phage phiPVL-CN125 NCBI   hypothetical protein CUR017
gi|40557234 Bacteriophage 77 NCBI   77ORF018
gi|41189533 Staphylococcus phage 77 NCBI   77ORF018
img|638305518 Bacteriophage 77 IMG   77ORF018
img|640794633 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640795381 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640796224 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641203571 Staphylococcus aureus phage phiNM provirus IMG   hypothetical protein
img|641204877 Staphylococcus phage phiPVL108 IMG   hypothetical protein
img|641210056 Staphylococcus phage tp310-3 provirus IMG   hypothetical protein
kegg|sae:NWMN_0273 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sae:NWMN_1001 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sae:NWMN_1807 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
ref|NP_958641.1 Staphylococcus phage 77 RefSeq   77ORF018
ref|YP_001331307.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0273
ref|YP_001332035.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1001
ref|YP_001332841.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1807
ref|YP_001429979.1 Staphylococcus phage tp310-3 RefSeq   hypothetical protein SPTP3103_gp17
ref|YP_002939688.1 Staphylococcus phage phiPVL-CN125 RefSeq   hypothetical protein CUR017
ref|YP_873965.1 Staphylococcus phage phiNM RefSeq   hypothetical protein SAPPV1_gp16
ref|YP_918910.1 Staphylococcus phage phiPVL108 RefSeq   hypothetical protein SABPV108_gp20
tr|A0EWI7 Staphylococcus aureus phage phiNM1 TrEMBL   Putative uncharacterized protein
tr|A0EWQ1 Staphylococcus aureus phage phiNM2 TrEMBL   Putative uncharacterized protein
tr|A0EX33 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|A0ZS22 Staphylococcus phage phiPVL108 TrEMBL   Putative uncharacterized protein
tr|A6QDW3 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A7TWM9 Staphylococcus phage tp310-3 TrEMBL   Putative uncharacterized protein
tr|A7YGQ7 Staphylococcus phage 80 TrEMBL   Conserved protein
tr|C5I641 Staphylococcus phage phiPVL-CN125 TrEMBL   Putative uncharacterized protein
tr|Q6R842 Staphylococcus phage 77 TrEMBL   77ORF018


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search