The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|387910.2.peg.16: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage ssDNA binding protein
Translate Function Assignments


Context on contig DQ530362 from base 1569 to 13062 (11494 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
3 2501 1569 933 -           Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73228.1, gi|104641920
4 2997 2533 465 - 31         Phage protein protein_id|ABF73229.1, gi|104641921
5 3324 3010 315 - 12         Phage repressor protein cI protein_id|ABF73230.1, gi|104641922
6 3476 3712 237 + 151         Phage transcriptional regulator cro protein_id|ABF73231.1, gi|104641923
7 3726 3905 180 + 13         Phage protein protein_id|ABF73232.1, gi|104641924
8 4488 4006 483 - 100         ORF029 protein_id|ABF73233.1, gi|104641925
9 4548 5297 750 + 59         Phage antirepressor protein protein_id|ABF73234.1, gi|104641926
10 5313 5531 219 + 15         Phage phi 11 orf9 protein homolog protein_id|ABF73235.1, gi|104641927
11 5561 5824 264 + 29         Phage protein protein_id|ABF73236.1, gi|104641928
12 5836 5997 162 + 11         Phage phi 11 orf10a protein homolog protein_id|ABF73237.1, gi|104641929
13 6089 6349 261 + 91         Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930
14 6359 6580 222 + 9         Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942
26 12560 12814 255 + -1         Phage protein protein_id|ABF73251.1, gi|104641943
27 12820 13062 243 + 5         Phage phi 11 orf22 protein homolog protein_id|ABF73252.1, gi|104641944

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Phage_replication RamyA Single stranded DNA-binding protein, phage-associated


  Protein Sequence

>fig|387910.2.peg.16 Phage ssDNA binding protein
MKITGQAQFTKETNQEKFYNGSAGFQAGEFTVKVKNIEFNDRENRYFTIVFENDEGKQYK
HNQFVPPYKYDFQEKQLIELVTRLGIKLNLPSLDFDTNDLIGKFCHLVLKWKFNEDEGKY
FTDFSFIKPYKKGDDVVNKPIPKTDKQKAEENNGAQQQTSMSQQSNPFESSGQFGYDDQD
LAF

MD5 = 28307ed3318649679f379a7de3c6f225


  DNA Sequence

>fig|387910.2.peg.16 Phage ssDNA binding protein
atgaaaatcacaggacaagcgcaatttactaaagaaacaaatcaagaaaagttttataac
ggctcagcagggtttcaagctggagaattcacagtgaaagttaaaaatattgaattcaat
gatagagaaaatagatatttcacaatcgtatttgaaaatgatgaaggcaaacaatataaa
cataatcaatttgtaccgccgtataaatatgatttccaagaaaaacaattgattgaatta
gttactcgattaggtattaagttaaatcttcctagcttagattttgataccaatgatctt
attggtaagttttgtcacttggtattgaaatggaaattcaatgaagatgaaggtaagtat
tttacggatttttcatttattaaaccttacaaaaagggcgatgatgttgttaacaaacct
attccgaagacagataagcaaaaagctgaagaaaataacggggcacaacaacaaacatca
atgtctcaacaaagcaatccatttgaaagcagtggccaatttggatatgacgaccaagat
ttagcgttttaa


  DNA with Flanking Sequence

>fig|387910.2.peg.16 Phage ssDNA binding protein
tattgaaactattcaaaaacttagagatatgacattgaatgatgtgatgaaaaataagtc
taaaaaaccaacgtttaatgattggggagaagttgctgaacgaattgtcagtatgtacag
attaataggaaaacttcaagaagaatacaaattccactttgttattacaggtcatgaagg
tatcaacaaagataaagatgatgaaggtagcactatcaaccctactatcactattgaagc
gcaagaacaaattaaaaaagctattacttctcaaagtgatgtgttagctagggcaatgat
tgaagaatttgatgataacggagaaaagaaagctagatatattctaaacgctgaaccttc
taatacgtttgaaacaaagattagacattcaccttcaataacaattaacaataagaaatt
tgcaaatcctagcattacggacgtagtagaagcaattagaaatggaaactaaaaattaat
taaaaggacggtatttaattatgaaaatcacaggacaagcgcaatttactaaagaaacaa
atcaagaaaagttttataacggctcagcagggtttcaagctggagaattcacagtgaaag
ttaaaaatattgaattcaatgatagagaaaatagatatttcacaatcgtatttgaaaatg
atgaaggcaaacaatataaacataatcaatttgtaccgccgtataaatatgatttccaag
aaaaacaattgattgaattagttactcgattaggtattaagttaaatcttcctagcttag
attttgataccaatgatcttattggtaagttttgtcacttggtattgaaatggaaattca
atgaagatgaaggtaagtattttacggatttttcatttattaaaccttacaaaaagggcg
atgatgttgttaacaaacctattccgaagacagataagcaaaaagctgaagaaaataacg
gggcacaacaacaaacatcaatgtctcaacaaagcaatccatttgaaagcagtggccaat
ttggatatgacgaccaagatttagcgttttaaggtgtggtttaaatgcaatacattacaa
gataccagaaagataacgacggtacttattccgtcgttgctactggtgttgaacttgaac
aaagtcacattgacttactagaaaacggatatccactaaaagcagaagtagaggttccgg
acaataaaaaactatctatagaacaacgcaaaaaaatattcgcaatgtgtagagatatag
aacttcactggggcgaaccagtagaatcaactagaaaattattacaaacagaattggaaa
ttatgaaaggttatgaagaaatcagtctgcgcgactgttctatgaaagttgcaagggagt
taatagaactgattatagcgtttatgtttcatcatcaaatacctatgagtgtagaaacga
gtaagttgttaagcgaagataaagcgttattatattgggctacaatcaaccgcaactgtg
taatatgcggaaagcctcacgcagacctggcacattatgaagcagtcggcag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2004 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
dbj|BAF43832.1 Staphylococcus phage phiETA2     hypothetical protein
dbj|BAF66544.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF67272.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF68080.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|186153.1.peg.13 Staphylococcus aureus phage phi 13 FIG   Phage ssDNA binding protein
fig|259901.1.peg.39 Bacteriophage 77 FIG   Phage ssDNA binding protein
fig|320833.3.peg.54 Bacteriophage 187 FIG   Phage ssDNA binding protein
fig|320843.3.peg.34 Bacteriophage ROSA FIG   Phage ssDNA binding protein
fig|320844.3.peg.50 Bacteriophage 71 FIG   Phage ssDNA binding protein
fig|320846.3.peg.56 Bacteriophage 29 FIG   Phage ssDNA binding protein
fig|326036.2.peg.17 Siphoviridae Staphylococcus phage phiETA2 FIG   Phage ssDNA binding protein
fig|387905.2.peg.15 Siphoviridae Staphylococcus phage phiNM FIG   Phage ssDNA binding protein
fig|387908.2.peg.15 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Phage ssDNA binding protein
fig|426430.6.peg.1752 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage ssDNA binding protein
fig|426430.6.peg.273 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage ssDNA binding protein
fig|426430.6.peg.972 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage ssDNA binding protein
fig|426430.8.peg.1089 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage ssDNA binding protein
fig|426430.8.peg.1958 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage ssDNA binding protein
fig|426430.8.peg.295 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage ssDNA binding protein
fig|553573.3.peg.468 Staphylococcus aureus A8115 FIG   Phage ssDNA binding protein
fig|553574.3.peg.1997 Staphylococcus aureus A8117 FIG   Phage ssDNA binding protein
fig|553581.3.peg.595 Staphylococcus aureus A9299 FIG   Phage ssDNA binding protein
fig|55511.2.peg.54 Siphoviridae Staphylococcus phage 187 FIG   Phage ssDNA binding protein
fig|585150.3.peg.2463 Staphylococcus aureus subsp. aureus C160 FIG   Phage ssDNA binding protein
fig|585152.3.peg.1824 Staphylococcus aureus subsp. aureus D139 FIG   Phage ssDNA binding protein
fig|585153.3.peg.2157 Staphylococcus aureus subsp. aureus E1410 FIG   Phage ssDNA binding protein
fig|585155.3.peg.2448 Staphylococcus aureus subsp. aureus H19 FIG   Phage ssDNA binding protein
fig|644279.4.peg.1264 Staphylococcus aureus subsp. aureus 132 FIG   Phage ssDNA binding protein
fig|93061.3.peg.2097 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage ssDNA binding protein
fig|93061.5.peg.2015 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage ssDNA binding protein
gb|AAL82343.1 Staphylococcus aureus phage phi 13     phi ETA orf 18-like protein
gb|AAR87894.1 Bacteriophage 77     77ORF022
gb|AAX90702.1 Bacteriophage 187     ORF024
gb|AAX91517.1 Bacteriophage ROSA     ORF022
gb|AAX91595.1 Bacteriophage 71     ORF025
gb|AAX91743.1 Bacteriophage 29     ORF024
gb|ABD31262.1 Staphylococcus aureus subsp. aureus NCTC 8325     phi ETA orf 18-like protein
gb|ABF73045.1 Staphylococcus aureus phage phiNM1     hypothetical protein
gb|ABF73109.1 Staphylococcus aureus phage phiNM2     hypothetical protein
gb|ABF73241.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gb|EEV11423.1 Staphylococcus aureus subsp. aureus E1410     conserved hypothetical protein
gb|EEV73363.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV76039.1 Staphylococcus aureus A8115     conserved hypothetical protein
gi|104641631 Staphylococcus aureus phage phiNM1 NCBI   hypothetical protein
gi|104641731 Staphylococcus aureus phage phiNM2 NCBI   hypothetical protein
gi|104641933 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|118430739 Staphylococcus phage phiNM NCBI   hypothetical protein SAPPV1_gp15
gi|121309210 Staphylococcus phage phiETA2 NCBI   hypothetical protein
gi|122891731 Staphylococcus phage phiETA2 NCBI   hypothetical protein phiETA2_gp17
gi|150373284 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150374012 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150374820 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220484 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0272
gi|151221212 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1000
gi|151222020 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1808
gi|18920604 Staphylococcus aureus phage phi 13 NCBI   phi ETA orf 18-like protein
gi|257281286 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257433193 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257849392 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257852110 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258431162 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258441938 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|29028680 Staphylococcus phage phi13 NCBI   phi ETA orf 18-like protein
gi|40557238 Bacteriophage 77 NCBI   77ORF022
gi|41189537 Staphylococcus phage 77 NCBI   77ORF022
gi|62635591 Bacteriophage 187 NCBI   ORF024
gi|62636406 Bacteriophage ROSA NCBI   ORF022
gi|62636484 Bacteriophage 71 NCBI   ORF025
gi|62636632 Bacteriophage 29 NCBI   ORF024
gi|66395239 Staphylococcus phage 187 NCBI   ORF024
gi|66395986 Staphylococcus phage ROSA NCBI   ORF022
gi|66396065 Staphylococcus phage 71 NCBI   ORF025
gi|66396215 Staphylococcus phage 29 NCBI   ORF024
gi|87203452 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi ETA orf 18-like protein
gi|88195894 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi ETA orf 18-like protein
img|637894839 Staphylococcus aureus aureus NCTC 8325 IMG   phi ETA orf 18-like protein
img|638297110 Staphylococcus aureus phage phi 13 IMG   phi ETA orf 18-like protein
img|638305517 Bacteriophage 77 IMG   77ORF022
img|638313960 Bacteriophage 187 IMG   ORF024
img|638314771 Bacteriophage ROSA IMG   ORF022
img|638314848 Bacteriophage 71 IMG   ORF025
img|638315003 Bacteriophage 29 IMG   ORF024
img|640794632 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640795380 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640796225 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641203570 Staphylococcus aureus phage phiNM provirus IMG   hypothetical protein
img|641206399 Staphylococcus phage phiETA2 IMG   hypothetical protein
kegg|sae:NWMN_0272 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sae:NWMN_1000 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sae:NWMN_1808 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_02220 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phi ETA orf 18-like protein
ref|NP_803368.1 Staphylococcus phage phi13 RefSeq   phi ETA orf 18-like protein
ref|NP_958640.1 Staphylococcus phage 77 RefSeq   77ORF022
ref|YP_001004277.1 Staphylococcus phage phiETA2 RefSeq   hypothetical protein phiETA2_gp17
ref|YP_001331306.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0272
ref|YP_001332034.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1000
ref|YP_001332842.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1808
ref|YP_239541.1 Staphylococcus phage 187 RefSeq   ORF024
ref|YP_240352.1 Staphylococcus phage ROSA RefSeq   ORF022
ref|YP_240429.1 Staphylococcus phage 71 RefSeq   ORF025
ref|YP_240584.1 Staphylococcus phage 29 RefSeq   ORF024
ref|YP_500705.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phi ETA orf 18-like protein
ref|YP_873964.1 Staphylococcus phage phiNM RefSeq   hypothetical protein SAPPV1_gp15
ref|ZP_05609551.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   conserved hypothetical protein
ref|ZP_05688567.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05691056.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
tr|A0EWI6 Staphylococcus aureus phage phiNM1 TrEMBL   Putative uncharacterized protein
tr|A0EWQ0 Staphylococcus aureus phage phiNM2 TrEMBL   Putative uncharacterized protein
tr|A0EX32 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|A1KWZ9 Staphylococcus phage phiETA2 TrEMBL   Putative uncharacterized protein
tr|A6QDW2 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|Q2FWR0 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Phi ETA orf 18-like protein
tr|Q4ZAZ2 Staphylococcus phage 29 TrEMBL   ORF024
tr|Q4ZBE7 Staphylococcus phage 71 TrEMBL   ORF025
tr|Q4ZBM4 Staphylococcus phage ROSA TrEMBL   ORF022
tr|Q4ZDY5 Staphylococcus phage 187 TrEMBL   ORF024
tr|Q6R843 Staphylococcus phage 77 TrEMBL   77ORF022
tr|Q8SDM3 Staphylococcus phage phi13 (Bacteriophage phi-13) TrEMBL   Phi ETA orf 18-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search