The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.15: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage phi 11 orf12 protein homolog
Translate Function Assignments



Context on contig DQ530362 from base 1410 to 12560 (11151 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2 1410 1589 180 +           Phage excisionase protein_id|ABF73227.1, gi|104641919
3 2501 1569 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73228.1, gi|104641920
4 2997 2533 465 - 31         Phage protein protein_id|ABF73229.1, gi|104641921
5 3324 3010 315 - 12         Phage repressor protein cI protein_id|ABF73230.1, gi|104641922
6 3476 3712 237 + 151         Phage transcriptional regulator cro protein_id|ABF73231.1, gi|104641923
7 3726 3905 180 + 13         Phage protein protein_id|ABF73232.1, gi|104641924
8 4488 4006 483 - 100         ORF029 protein_id|ABF73233.1, gi|104641925
9 4548 5297 750 + 59         Phage antirepressor protein protein_id|ABF73234.1, gi|104641926
10 5313 5531 219 + 15         Phage phi 11 orf9 protein homolog protein_id|ABF73235.1, gi|104641927
11 5561 5824 264 + 29         Phage protein protein_id|ABF73236.1, gi|104641928
12 5836 5997 162 + 11         Phage phi 11 orf10a protein homolog protein_id|ABF73237.1, gi|104641929
13 6089 6349 261 + 91         Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930
14 6359 6580 222 + 9         Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937
21 11206 11364 159 + -7         Phage protein protein_id|ABF73246.1, gi|104641938
22 11377 11598 222 + 12         Phage phi 11 orf17 protein homolog protein_id|ABF73247.1, gi|104641939
23 11608 12015 408 + 9         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) protein_id|ABF73248.1, gi|104641940
24 12015 12200 186 + -1         Phage phi 11 orf19 protein homolog protein_id|ABF73249.1, gi|104641941
25 12201 12560 360 + 0         Phage phi 11 orf21 protein homolog protein_id|ABF73250.1, gi|104641942

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.15 Phage phi 11 orf12 protein homolog
MTEEKQEPQEKVSILKKLKINNIAEKNKRKFYKFAVYGKIGSGKTTFATRDKDAFVIDIN
EGGTTVTDEGSDVEIENYQHFVYVVNFLPQILQEMRENGQEINVVVIETIQKLRDMTLND
VMKNKSKKPTFNDWGEVAERIVSMYRLIGKLQEEYKFHFVITGHEGINKDKDDEGSTINP
TITIEAQEQIKKAITSQSDVLARAMIEEFDDNGEKKARYILNAEPSNTFETKIRHSPSIT
INNKKFANPSITDVVEAIRNGN

MD5 = b3d978dd96f106748a4ddebd2182133d


  DNA Sequence

>fig|387910.2.peg.15 Phage phi 11 orf12 protein homolog
atgactgaggaaaaacaagaaccacaagaaaaagtaagcatactcaaaaaactaaagata
aataatatcgctgagaaaaataaaaggaaattctataaatttgcagtatacggaaaaatt
ggctcaggaaaaaccacgtttgctacaagagataaagacgctttcgtcattgacattaac
gaaggtggaacaacggttactgacgaaggatcagacgtagaaatcgagaactatcaacac
tttgtttatgttgtaaattttttacctcaaattttacaggagatgagagaaaacggacaa
gaaatcaatgttgtagttattgaaactattcaaaaacttagagatatgacattgaatgat
gtgatgaaaaataagtctaaaaaaccaacgtttaatgattggggagaagttgctgaacga
attgtcagtatgtacagattaataggaaaacttcaagaagaatacaaattccactttgtt
attacaggtcatgaaggtatcaacaaagataaagatgatgaaggtagcactatcaaccct
actatcactattgaagcgcaagaacaaattaaaaaagctattacttctcaaagtgatgtg
ttagctagggcaatgattgaagaatttgatgataacggagaaaagaaagctagatatatt
ctaaacgctgaaccttctaatacgtttgaaacaaagattagacattcaccttcaataaca
attaacaataagaaatttgcaaatcctagcattacggacgtagtagaagcaattagaaat
ggaaactaa


  DNA with Flanking Sequence

>fig|387910.2.peg.15 Phage phi 11 orf12 protein homolog
aacggaggaagtcaagatgtattacgaaataggcgaaatcatacgcaaaaatattcatgt
taacggattcgattttaagctattcattttaaaaggtcatatgggcatatcaatacaagt
taaagatatgaacaacgtaccaattaaacatgcttatgtcgtagatgagaatgacttaga
tatggcatcagacttatttaaccaagcaatagatgaatggattgaagagaacacagacga
acaggacagactaattaacttagtcatgaaatggtaggaggtcgctatgaagcagactgt
aacttatatcattcgtcatagggatatgccaatttatataactaacaaaccaactgataa
caattcagatattagttactccacaaatagaaatagagctagggagtttaacggtatgga
agaagcgagtatcaatatggattatcacaaagcaatcaagaaaacagtgacagaaactat
tgagtacgaggaggtagaacatgactgaggaaaaacaagaaccacaagaaaaagtaagca
tactcaaaaaactaaagataaataatatcgctgagaaaaataaaaggaaattctataaat
ttgcagtatacggaaaaattggctcaggaaaaaccacgtttgctacaagagataaagacg
ctttcgtcattgacattaacgaaggtggaacaacggttactgacgaaggatcagacgtag
aaatcgagaactatcaacactttgtttatgttgtaaattttttacctcaaattttacagg
agatgagagaaaacggacaagaaatcaatgttgtagttattgaaactattcaaaaactta
gagatatgacattgaatgatgtgatgaaaaataagtctaaaaaaccaacgtttaatgatt
ggggagaagttgctgaacgaattgtcagtatgtacagattaataggaaaacttcaagaag
aatacaaattccactttgttattacaggtcatgaaggtatcaacaaagataaagatgatg
aaggtagcactatcaaccctactatcactattgaagcgcaagaacaaattaaaaaagcta
ttacttctcaaagtgatgtgttagctagggcaatgattgaagaatttgatgataacggag
aaaagaaagctagatatattctaaacgctgaaccttctaatacgtttgaaacaaagatta
gacattcaccttcaataacaattaacaataagaaatttgcaaatcctagcattacggacg
tagtagaagcaattagaaatggaaactaaaaattaattaaaaggacggtatttaattatg
aaaatcacaggacaagcgcaatttactaaagaaacaaatcaagaaaagttttataacggc
tcagcagggtttcaagctggagaattcacagtgaaagttaaaaatattgaattcaatgat
agagaaaatagatatttcacaatcgtatttgaaaatgatgaaggcaaacaatataaacat
aatcaatttgtaccgccgtataaatatgatttccaagaaaaacaattgattgaattagtt
actcgattaggtattaagttaaatcttcctagcttagattttgataccaatgatcttatt
ggtaagttttgtcacttggtattgaaatggaaattcaatgaagatgaaggtaagtatttt
acggatttttcatttattaaaccttacaaaaagggcgatgatgttgttaacaaacctatt
ccgaagacagataagcaaaaagctgaagaaaataacggggcacaacaac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAF66543.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF68081.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|259901.1.peg.38 Bacteriophage 77 FIG   Phage phi 11 orf12 protein homolog
fig|320834.3.peg.49 Bacteriophage 69 FIG   Phage phi 11 orf12 protein homolog
fig|320843.3.peg.6 Bacteriophage ROSA FIG   Phage phi 11 orf12 protein homolog
fig|320846.3.peg.55 Bacteriophage 29 FIG   Phage phi 11 orf12 protein homolog
fig|387905.2.peg.14 Siphoviridae Staphylococcus phage phiNM FIG   Phage phi 11 orf12 protein homolog
fig|426430.6.peg.1753 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf12 protein homolog
fig|426430.6.peg.272 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf12 protein homolog
fig|426430.8.peg.1959 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf12 protein homolog
fig|426430.8.peg.294 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf12 protein homolog
fig|553581.3.peg.705 Staphylococcus aureus A9299 FIG   Phage phi 11 orf12 protein homolog
fig|585150.3.peg.2464 Staphylococcus aureus subsp. aureus C160 FIG   Phage phi 11 orf12 protein homolog
fig|585152.3.peg.1825 Staphylococcus aureus subsp. aureus D139 FIG   Phage phi 11 orf12 protein homolog
fig|585153.3.peg.2156 Staphylococcus aureus subsp. aureus E1410 FIG   Phage phi 11 orf12 protein homolog
fig|585155.3.peg.2449 Staphylococcus aureus subsp. aureus H19 FIG   Phage phi 11 orf12 protein homolog
gb|AAR87884.1 Bacteriophage 77     77ORF012
gb|AAX90770.1 Bacteriophage 69     ORF015
gb|AAX91510.1 Bacteriophage ROSA     ORF014
gb|AAX91736.1 Bacteriophage 29     ORF017
gb|ABF73044.1 Staphylococcus aureus phage phiNM1     hypothetical protein
gb|ABF73240.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gb|EEV11422.1 Staphylococcus aureus subsp. aureus E1410     conserved hypothetical protein
gb|EEV73256.1 Staphylococcus aureus A9299     conserved hypothetical protein
gi|104641630 Staphylococcus aureus phage phiNM1 NCBI   hypothetical protein
gi|104641932 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|118430738 Staphylococcus phage phiNM NCBI   hypothetical protein SAPPV1_gp14
gi|150373283 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150374821 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220483 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0271
gi|151222021 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1809
gi|257281285 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257433192 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257849276 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258433942 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|40557228 Bacteriophage 77 NCBI   77ORF012
gi|41189527 Staphylococcus phage 77 NCBI   77ORF012
gi|62635659 Bacteriophage 69 NCBI   ORF015
gi|62636399 Bacteriophage ROSA NCBI   ORF014
gi|62636625 Bacteriophage 29 NCBI   ORF017
gi|66395308 Staphylococcus phage 69 NCBI   ORF015
gi|66395979 Staphylococcus phage ROSA NCBI   ORF014
gi|66396208 Staphylococcus phage 29 NCBI   ORF017
img|638305516 Bacteriophage 77 IMG   77ORF012
img|638314032 Bacteriophage 69 IMG   ORF015
img|638314770 Bacteriophage ROSA IMG   ORF014
img|638315002 Bacteriophage 29 IMG   ORF017
img|640794631 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640796226 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641203569 Staphylococcus aureus phage phiNM provirus IMG   hypothetical protein
kegg|sae:NWMN_0271 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sae:NWMN_1809 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
ref|NP_958639.1 Staphylococcus phage 77 RefSeq   77ORF012
ref|YP_001331305.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0271
ref|YP_001332843.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1809
ref|YP_239613.1 Staphylococcus phage 69 RefSeq   ORF015
ref|YP_240351.1 Staphylococcus phage ROSA RefSeq   ORF014
ref|YP_240583.1 Staphylococcus phage 29 RefSeq   ORF017
ref|YP_873963.1 Staphylococcus phage phiNM RefSeq   hypothetical protein SAPPV1_gp14
ref|ZP_05609550.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   conserved hypothetical protein
ref|ZP_05688675.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
tr|A0EWI5 Staphylococcus aureus phage phiNM1 TrEMBL   Putative uncharacterized protein
tr|A0EX31 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|A6QDW1 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|Q4ZAZ3 Staphylococcus phage 29 TrEMBL   ORF017
tr|Q4ZBM5 Staphylococcus phage ROSA TrEMBL   ORF014
tr|Q4ZDR3 Staphylococcus phage 69 TrEMBL   ORF015
tr|Q6R844 Staphylococcus phage 77 TrEMBL   77ORF012


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search