The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.12: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage phi 11 orf10a protein homolog
Translate Function Assignments



Context on contig DQ530362 from base 94 to 11212 (11119 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1 1299 94 1206 -       1: 2   Phage integrase protein_id|ABF73226.1, gene_name|int, gi|104641918
2 1410 1589 180 + 110         Phage excisionase protein_id|ABF73227.1, gi|104641919
3 2501 1569 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73228.1, gi|104641920
4 2997 2533 465 - 31         Phage protein protein_id|ABF73229.1, gi|104641921
5 3324 3010 315 - 12         Phage repressor protein cI protein_id|ABF73230.1, gi|104641922
6 3476 3712 237 + 151         Phage transcriptional regulator cro protein_id|ABF73231.1, gi|104641923
7 3726 3905 180 + 13         Phage protein protein_id|ABF73232.1, gi|104641924
8 4488 4006 483 - 100         ORF029 protein_id|ABF73233.1, gi|104641925
9 4548 5297 750 + 59         Phage antirepressor protein protein_id|ABF73234.1, gi|104641926
10 5313 5531 219 + 15         Phage phi 11 orf9 protein homolog protein_id|ABF73235.1, gi|104641927
11 5561 5824 264 + 29         Phage protein protein_id|ABF73236.1, gi|104641928
12 5836 5997 162 + 11         Phage phi 11 orf10a protein homolog protein_id|ABF73237.1, gi|104641929
13 6089 6349 261 + 91         Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930
14 6359 6580 222 + 9         Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.12 Phage phi 11 orf10a protein homolog
MSNIYKSYLVAVLCFTVLAIVLMPFLYFTTAWSIAGFASIATFMYYKECFFKE

MD5 = 2c71177203c1046697550e4bafd8f798


  DNA Sequence

>fig|387910.2.peg.12 Phage phi 11 orf10a protein homolog
atgagcaacatttataaaagctacctagtagcagtattatgcttcacagtcttagcgatt
gtacttatgccgtttctatacttcactacagcatggtcaattgcgggattcgcaagtatc
gcaacattcatgtactacaaagaatgctttttcaaagaataa


  DNA with Flanking Sequence

>fig|387910.2.peg.12 Phage phi 11 orf10a protein homolog
cctcctcatcacaatggcagttgtgacgtggaaggtttggaagattgagaagcacactag
aaaacctgtgattagtagcagggcgttgagtgactatctaaacaacaaatctttaaccat
accgaaagatgctgaaaattctactgaatctgctcgtcgccttttgaagttcgccgaaca
aactattagcaaataacaacattatacacgaaaggaaagatagaaatgccaaaaatcata
gtaccaccaacaccagaaaacacatatagaggcgaagaaaaatttgtgaaaaagttatac
gcaacacctacacaaatccatcaattgtttggagtatgtagaagtacagtatacaactgg
ttgaaatattaccgcaaagataatttaggtgtagaaaatttatacattgattattcacca
acaggcactctgattaatatttctaaattggaagagtatttgatcagaaagcataaaaaa
tggtattaggaggatattaaatgagcaacatttataaaagctacctagtagcagtattat
gcttcacagtcttagcgattgtacttatgccgtttctatacttcactacagcatggtcaa
ttgcgggattcgcaagtatcgcaacattcatgtactacaaagaatgctttttcaaagaat
aaaaaaactgctacttgttggagcaagtaacagtatcaaacacttaagaaaaaattcatg
ttcaatataaaacgaaaaacggaggaagtcaagatgtattacgaaataggcgaaatcata
cgcaaaaatattcatgttaacggattcgattttaagctattcattttaaaaggtcatatg
ggcatatcaatacaagttaaagatatgaacaacgtaccaattaaacatgcttatgtcgta
gatgagaatgacttagatatggcatcagacttatttaaccaagcaatagatgaatggatt
gaagagaacacagacgaacaggacagactaattaacttagtcatgaaatggtaggaggtc
gctatgaagcagactgtaacttatatcattcgtcatagggatatgccaatttatataact
aacaaaccaactgataacaattcagatattagttactccacaaatagaaatagagctagg
gagtttaacggtatggaagaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|259901.1.peg.35 Bacteriophage 77 FIG   Phage phi 11 orf10a protein homolog
fig|320843.3.peg.2 Bacteriophage ROSA FIG   Phage phi 11 orf10a protein homolog
fig|387905.2.peg.11 Siphoviridae Staphylococcus phage phiNM FIG   Phage phi 11 orf10a protein homolog
fig|426430.8.peg.1962 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf10a protein homolog
fig|426430.8.peg.291 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf10a protein homolog
fig|585155.3.peg.2452 Staphylococcus aureus subsp. aureus H19 FIG   Phage phi 11 orf10a protein homolog
gb|AAR87934.1 Bacteriophage 77     77ORF102
gb|AAX91562.1 Bacteriophage ROSA     ORF115
gb|ABF73041.1 Staphylococcus aureus phage phiNM1     hypothetical protein
gb|ABF73237.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gi|104641627 Staphylococcus aureus phage phiNM1 NCBI   hypothetical protein
gi|104641929 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|118430735 Staphylococcus phage phiNM NCBI   hypothetical protein SAPPV1_gp11
gi|40557278 Bacteriophage 77 NCBI   77ORF102
gi|41189577 Staphylococcus phage 77 NCBI   77ORF102
gi|62636451 Bacteriophage ROSA NCBI   ORF115
gi|66396031 Staphylococcus phage ROSA NCBI   ORF115
img|638305513 Bacteriophage 77 IMG   77ORF102
img|638314766 Bacteriophage ROSA IMG   ORF115
img|641203566 Staphylococcus aureus phage phiNM provirus IMG   hypothetical protein
ref|NP_958636.1 Staphylococcus phage 77 RefSeq   77ORF102
ref|YP_240347.1 Staphylococcus phage ROSA RefSeq   ORF115
ref|YP_873960.1 Staphylococcus phage phiNM RefSeq   hypothetical protein SAPPV1_gp11
tr|A0EWI2 Staphylococcus aureus phage phiNM1 TrEMBL   Putative uncharacterized protein
tr|A0EX28 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|Q4ZBM9 Staphylococcus phage ROSA TrEMBL   ORF115
tr|Q6R847 Staphylococcus phage 77 TrEMBL   77ORF102


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search