The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|387910.2.peg.11: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage protein
Translate Function Assignments


Context on contig DQ530362 from base 94 to 11212 (11119 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
1 1299 94 1206 -       1: 2   Phage integrase protein_id|ABF73226.1, gene_name|int, gi|104641918
2 1410 1589 180 + 110         Phage excisionase protein_id|ABF73227.1, gi|104641919
3 2501 1569 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73228.1, gi|104641920
4 2997 2533 465 - 31         Phage protein protein_id|ABF73229.1, gi|104641921
5 3324 3010 315 - 12         Phage repressor protein cI protein_id|ABF73230.1, gi|104641922
6 3476 3712 237 + 151         Phage transcriptional regulator cro protein_id|ABF73231.1, gi|104641923
7 3726 3905 180 + 13         Phage protein protein_id|ABF73232.1, gi|104641924
8 4488 4006 483 - 100         ORF029 protein_id|ABF73233.1, gi|104641925
9 4548 5297 750 + 59         Phage antirepressor protein protein_id|ABF73234.1, gi|104641926
10 5313 5531 219 + 15         Phage phi 11 orf9 protein homolog protein_id|ABF73235.1, gi|104641927
11 5561 5824 264 + 29         Phage protein protein_id|ABF73236.1, gi|104641928
12 5836 5997 162 + 11         Phage phi 11 orf10a protein homolog protein_id|ABF73237.1, gi|104641929
13 6089 6349 261 + 91         Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930
14 6359 6580 222 + 9         Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.11 Phage protein
MPKIIVPPTPENTYRGEEKFVKKLYATPTQIHQLFGVCRSTVYNWLKYYRKDNLGVENLY
IDYSPTGTLINISKLEEYLIRKHKKWY

MD5 = 19c73d8585a2db1786c35961e313873e


  DNA Sequence

>fig|387910.2.peg.11 Phage protein
atgccaaaaatcatagtaccaccaacaccagaaaacacatatagaggcgaagaaaaattt
gtgaaaaagttatacgcaacacctacacaaatccatcaattgtttggagtatgtagaagt
acagtatacaactggttgaaatattaccgcaaagataatttaggtgtagaaaatttatac
attgattattcaccaacaggcactctgattaatatttctaaattggaagagtatttgatc
agaaagcataaaaaatggtattag


  DNA with Flanking Sequence

>fig|387910.2.peg.11 Phage protein
atcgggcaacgcagattgtttgagtggttacgtcaaaacggattccttattaaacgcaag
ggtgtggattataacatgcctacacagtattcaatggaacgtgagttattcgaaattaaa
gaaacatcaatcacacattcggacggtcacacatcaattagtaagacgccaaaagtaaca
ggtaaaggacaacaatactttgttaacaagtttttaggagaaaaacaaacaacttaatag
gaggaattacaaatgaacgcactatacaaaacaaccctcctcatcacaatggcagttgtg
acgtggaaggtttggaagattgagaagcacactagaaaacctgtgattagtagcagggcg
ttgagtgactatctaaacaacaaatctttaaccataccgaaagatgctgaaaattctact
gaatctgctcgtcgccttttgaagttcgccgaacaaactattagcaaataacaacattat
acacgaaaggaaagatagaaatgccaaaaatcatagtaccaccaacaccagaaaacacat
atagaggcgaagaaaaatttgtgaaaaagttatacgcaacacctacacaaatccatcaat
tgtttggagtatgtagaagtacagtatacaactggttgaaatattaccgcaaagataatt
taggtgtagaaaatttatacattgattattcaccaacaggcactctgattaatatttcta
aattggaagagtatttgatcagaaagcataaaaaatggtattaggaggatattaaatgag
caacatttataaaagctacctagtagcagtattatgcttcacagtcttagcgattgtact
tatgccgtttctatacttcactacagcatggtcaattgcgggattcgcaagtatcgcaac
attcatgtactacaaagaatgctttttcaaagaataaaaaaactgctacttgttggagca
agtaacagtatcaaacacttaagaaaaaattcatgttcaatataaaacgaaaaacggagg
aagtcaagatgtattacgaaataggcgaaatcatacgcaaaaatattcatgttaacggat
tcgattttaagctattcattttaaaaggtcatatgggcatatcaatacaagttaaagata
tgaacaacgtaccaattaaacatgcttatgtcgtagatgagaatgacttagatatggcat
cagacttatttaaccaagcaatagatgaatggattgaagagaacacagacgaacaggaca
gact


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT09SA0905 Staphylococcus aureus subsp. aureus MSSA476     putative DNA-binding protein
cmr|SAUSA300_1430 Staphylococcus aureus subsp. aureus USA300-FPR3757     phiSLT ORF 87-like protein, putative DNA-binding protein
dbj|BAA31911.1 Staphylococcus phage PVL     unnamed protein product
dbj|BAF66541.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAG74382.1 Staphylococcus phage phi2958PVL     hypothetical protein
emb|CAG42677.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative DNA-binding protein
fig|259901.1.peg.34 Bacteriophage 77 FIG   Phage protein
fig|282459.1.peg.896 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phage protein
fig|282459.5.peg.939 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phage protein
fig|320843.3.peg.1 Bacteriophage ROSA FIG   Phage protein
fig|359786.13.peg.359 Staphylococcus aureus subsp. aureus JH9 FIG   Phage protein
fig|359786.3.peg.1175 Staphylococcus aureus subsp. aureus JH9 FIG   Phage protein
fig|359787.11.peg.356 Staphylococcus aureus subsp. aureus JH1 FIG   Phage protein
fig|359787.3.peg.2086 Staphylococcus aureus subsp. aureus JH1 FIG   Phage protein
fig|367830.3.peg.2095 Staphylococcus aureus subsp. aureus USA300 FIG   Phage protein
fig|426430.8.peg.290 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage protein
fig|430796.2.peg.13 Viruses Staphylococcus phage phi2958PVL Viruses. FIG   Phage protein
fig|445517.2.peg.10 Viruses Staphylococcus phage tp310-3 Viruses. FIG   Phage protein
fig|451515.3.peg.1563 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Phage protein
fig|451516.9.peg.1568 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Phage protein
fig|505321.3.peg.2718 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Phage protein
fig|553568.3.peg.1410 Staphylococcus aureus A6224 FIG   Phage protein
fig|553571.3.peg.2235 Staphylococcus aureus A6300 FIG   Phage protein
fig|553581.3.peg.239 Staphylococcus aureus A9299 FIG   Phage protein
fig|553590.4.peg.565 Staphylococcus aureus A9754 FIG   Phage protein
fig|553594.3.peg.2715 Staphylococcus aureus A9765 FIG   Phage protein
fig|553601.3.peg.197 Staphylococcus aureus A10102 FIG   Phage protein
fig|585155.3.peg.2453 Staphylococcus aureus subsp. aureus H19 FIG   Phage protein
fig|644279.4.peg.1630 Staphylococcus aureus subsp. aureus 132 FIG   Phage protein
fig|648017.2.peg.13 Viruses Staphylococcus phage phiPVL-CN125 Viruses. FIG   Phage protein
fig|71366.1.peg.37 Staphylococcus aureus bacteriophage PVL FIG   Phage protein
fig|762962.3.peg.503 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Phage protein
gb|AAR87915.1 Bacteriophage 77     77ORF048
gb|AAX91546.1 Bacteriophage ROSA     ORF058
gb|ABD21732.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     phiSLT ORF 87-like protein, putative DNA-binding protein
gb|ABF73236.1 Staphylococcus aureus phage phiNM4     putative DNA binding protein
gb|ABQ48121.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0314
gb|ABR51185.1 Staphylococcus aureus subsp. aureus JH1     phiSLT ORF 87-like protein, putative DNA-binding protein
gb|ABS87539.1 Staphylococcus phage tp310-3     hypothetical protein
gb|ABX29489.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical bacteriophage protein
gb|ACR54199.1 Staphylococcus phage phiPVL-CN125     putative DNA-binding protein
gb|EEV73708.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV77158.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV80537.1 Staphylococcus aureus A6224     conserved hypothetical protein
gi|104641928 Staphylococcus aureus phage phiNM4 NCBI   putative DNA binding protein
gi|147739823 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0314
gi|148266754 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0314
gi|149945249 Staphylococcus aureus subsp. aureus JH1 NCBI   phiSLT ORF 87-like protein, putative DNA-binding protein
gi|150373281 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150392797 Staphylococcus aureus subsp. aureus JH1 NCBI   phiSLT ORF 87-like protein, putative DNA-binding protein
gi|151220481 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0269
gi|154818113 Staphylococcus phage tp310-3 NCBI   hypothetical protein
gi|156604027 Staphylococcus phage tp310-3 NCBI   hypothetical protein SPTP3103_gp10
gi|160368518 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical bacteriophage protein
gi|161509709 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1481
gi|208973066 Staphylococcus phage phi2958PVL NCBI   hypothetical protein
gi|209363565 Staphylococcus phage phi2958PVL NCBI   hypothetical protein phi2958PVL_gp13
gi|238683996 Staphylococcus phage phiPVL-CN125 NCBI   putative DNA-binding protein
gi|239507371 Staphylococcus phage phiPVL-CN125 NCBI   putative DNA-binding protein
gi|253317132 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   phiSLT ORF 87-like protein, putative DNA-binding protein
gi|257849744 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257854205 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257857643 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258428689 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258447192 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258449094 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|3341945 Staphylococcus phage PVL NCBI   unnamed protein product
gi|40557259 Bacteriophage 77 NCBI   77ORF048
gi|41189558 Staphylococcus phage 77 NCBI   77ORF048
gi|49244251 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative DNA-binding protein
gi|49485808 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative DNA-binding protein
gi|62636435 Bacteriophage ROSA NCBI   ORF058
gi|66396015 Staphylococcus phage ROSA NCBI   ORF058
gi|87127218 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phiSLT ORF 87-like protein, putative DNA-binding protein
gi|87161244 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phiSLT ORF 87-like protein, putative DNA-binding protein
gi|9635202 Staphylococcus phage PVL NCBI   hypothetical protein PVL_37
img|637157130 Staphylococcus aureus aureus MSSA476 IMG   putative DNA-binding protein
img|637888082 Staphylococcus aureus aureus USA300 IMG   phiSLT ORF 87-like protein, putative DNA-binding protein
img|638284556 Staphylococcus aureus bacteriophage PVL IMG   hypothetical protein
img|638305512 Bacteriophage 77 IMG   77ORF048
img|638314765 Bacteriophage ROSA IMG   ORF058
img|639108331 Staphylococcus aureus aureus JH1 IMG   putative DNA-binding protein
img|640564644 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778393 Staphylococcus aureus aureus JH1 IMG   phiSLT ORF 87-like protein, putative DNA-binding protein
img|640794629 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641210049 Staphylococcus phage tp310-3 provirus IMG   hypothetical protein
img|641309441 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical bacteriophage protein
img|641772065 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical bacteriophage protein
kegg|saa:SAUSA300_1430 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   phiSLT ORF 87-like protein, putative DNA-binding protein
kegg|sae:NWMN_0269 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0323 Staphylococcus aureus subsp. aureus JH1 KEGG   phiSLT ORF 87-like protein, putative DNA-binding protein
kegg|saj:SaurJH9_0314 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sas:SAS0902   KEGG   putative DNA-binding protein
kegg|sax:USA300HOU_1481 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_058476.1 Staphylococcus phage PVL RefSeq   hypothetical protein PVL_37
ref|NP_958635.1 Staphylococcus phage 77 RefSeq   77ORF048
ref|YP_001245697.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0314
ref|YP_001315472.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   phiSLT ORF 87-like protein, putative DNA-binding protein
ref|YP_001331303.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0269
ref|YP_001429972.1 Staphylococcus phage tp310-3 RefSeq   hypothetical protein SPTP3103_gp10
ref|YP_001575368.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1481
ref|YP_002267983.1 Staphylococcus phage phi2958PVL RefSeq   hypothetical protein phi2958PVL_gp13
ref|YP_002939681.1 Staphylococcus phage phiPVL-CN125 RefSeq   putative DNA-binding protein
ref|YP_043029.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative DNA-binding protein
ref|YP_240346.1 Staphylococcus phage ROSA RefSeq   ORF058
ref|YP_494127.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   phiSLT ORF 87-like protein, putative DNA-binding protein
ref|ZP_04840345.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   phiSLT ORF 87-like protein, putative DNA-binding protein
ref|ZP_05688223.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05695342.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05697201.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
tr|A0EX27 Staphylococcus aureus phage phiNM4 TrEMBL   Putative DNA binding protein
tr|A5IPJ8 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6QDV9 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TYB7 Staphylococcus aureus (strain JH1) TrEMBL   PhiSLT ORF 87-like protein, putative DNA-binding protein
tr|A7TWM2 Staphylococcus phage tp310-3 TrEMBL   Putative uncharacterized protein
tr|A8Z2B4 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical bacteriophage protein
tr|B5WZL9 Staphylococcus phage phi2958PVL TrEMBL   Putative uncharacterized protein
tr|C5I634 Staphylococcus phage phiPVL-CN125 TrEMBL   Putative DNA-binding protein
tr|O80076 Staphylococcus phage PVL TrEMBL   Orf 37
tr|Q2FGQ1 Staphylococcus aureus (strain USA300) TrEMBL   PhiSLT ORF 87-like protein, putative DNA-binding protein
tr|Q4ZBN0 Staphylococcus phage ROSA TrEMBL   ORF058
tr|Q6GAP4 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative DNA-binding protein
tr|Q6R848 Staphylococcus phage 77 TrEMBL   77ORF048


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search