The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|387910.2.peg.10: Siphoviridae Staphylococcus aureus phage phiNM4

This feature in The SEED Viewer

NCBI Taxonomy Id: 387910

Current Assignment: Phage phi 11 orf9 protein homolog
Translate Function Assignments



Context on contig DQ530362 from base 94 to 11212 (11119 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1 1299 94 1206 -       1: 2   Phage integrase protein_id|ABF73226.1, gene_name|int, gi|104641918
2 1410 1589 180 + 110         Phage excisionase protein_id|ABF73227.1, gi|104641919
3 2501 1569 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] protein_id|ABF73228.1, gi|104641920
4 2997 2533 465 - 31         Phage protein protein_id|ABF73229.1, gi|104641921
5 3324 3010 315 - 12         Phage repressor protein cI protein_id|ABF73230.1, gi|104641922
6 3476 3712 237 + 151         Phage transcriptional regulator cro protein_id|ABF73231.1, gi|104641923
7 3726 3905 180 + 13         Phage protein protein_id|ABF73232.1, gi|104641924
8 4488 4006 483 - 100         ORF029 protein_id|ABF73233.1, gi|104641925
9 4548 5297 750 + 59         Phage antirepressor protein protein_id|ABF73234.1, gi|104641926
10 5313 5531 219 + 15         Phage phi 11 orf9 protein homolog protein_id|ABF73235.1, gi|104641927
11 5561 5824 264 + 29         Phage protein protein_id|ABF73236.1, gi|104641928
12 5836 5997 162 + 11         Phage phi 11 orf10a protein homolog protein_id|ABF73237.1, gi|104641929
13 6089 6349 261 + 91         Phage phi 11 orf11 protein homolog protein_id|ABF73238.1, gi|104641930
14 6359 6580 222 + 9         Phage phi-ETA orf16 protein homolog protein_id|ABF73239.1, gi|104641931
15 6573 7361 789 + -8         Phage phi 11 orf12 protein homolog protein_id|ABF73240.1, gi|104641932
16 7390 7941 552 + 28     1: 1   Phage ssDNA binding protein protein_id|ABF73241.1, gi|104641933
17 7954 8625 672 + 12         Phage phi 11 orf14 protein homolog protein_id|ABF73242.1, gi|104641934
18 9588 8731 858 - 105         Phage protein protein_id|ABF73243.1, gi|104641935
19 9653 10423 771 + 64     1: 1   Phage DNA replication protein O protein_id|ABF73244.1, gi|104641936
20 10433 11212 780 + 9         Phage DNA helicase loader protein_id|ABF73245.1, gi|104641937

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|387910.2.peg.10 Phage phi 11 orf9 protein homolog
MNALYKTTLLITMAVVTWKVWKIEKHTRKPVISSRALSDYLNNKSLTIPKDAENSTESAR
RLLKFAEQTISK

MD5 = 65bd29a82c239b0bf6a3ad74bef776f4


  DNA Sequence

>fig|387910.2.peg.10 Phage phi 11 orf9 protein homolog
atgaacgcactatacaaaacaaccctcctcatcacaatggcagttgtgacgtggaaggtt
tggaagattgagaagcacactagaaaacctgtgattagtagcagggcgttgagtgactat
ctaaacaacaaatctttaaccataccgaaagatgctgaaaattctactgaatctgctcgt
cgccttttgaagttcgccgaacaaactattagcaaataa


  DNA with Flanking Sequence

>fig|387910.2.peg.10 Phage phi 11 orf9 protein homolog
cgatgatgtcaggtacagaaaaaggttttgattttagagagtatttcatccaaattgaaa
aagcatggaacagtccagaaatgattatgcaacgtgctttaaaaattgctaacaacacaa
tcaatcaattagagacaaagattgaacgtgataaaccaaaaattgtatttgcagatgcag
tagctactactaagacatcaattttagttggagagttagcaaagatcattaaacaaaacg
gtataaacatcgggcaacgcagattgtttgagtggttacgtcaaaacggattccttatta
aacgcaagggtgtggattataacatgcctacacagtattcaatggaacgtgagttattcg
aaattaaagaaacatcaatcacacattcggacggtcacacatcaattagtaagacgccaa
aagtaacaggtaaaggacaacaatactttgttaacaagtttttaggagaaaaacaaacaa
cttaataggaggaattacaaatgaacgcactatacaaaacaaccctcctcatcacaatgg
cagttgtgacgtggaaggtttggaagattgagaagcacactagaaaacctgtgattagta
gcagggcgttgagtgactatctaaacaacaaatctttaaccataccgaaagatgctgaaa
attctactgaatctgctcgtcgccttttgaagttcgccgaacaaactattagcaaataac
aacattatacacgaaaggaaagatagaaatgccaaaaatcatagtaccaccaacaccaga
aaacacatatagaggcgaagaaaaatttgtgaaaaagttatacgcaacacctacacaaat
ccatcaattgtttggagtatgtagaagtacagtatacaactggttgaaatattaccgcaa
agataatttaggtgtagaaaatttatacattgattattcaccaacaggcactctgattaa
tatttctaaattggaagagtatttgatcagaaagcataaaaaatggtattaggaggatat
taaatgagcaacatttataaaagctacctagtagcagtattatgcttcacagtcttagcg
attgtacttatgccgtttctatacttcactacagcatggtcaattgcgggattcgcaagt
atcgcaacattcatgtactacaaagaatgctttttcaaagaataaaaaaactgctacttg
ttggagcaagtaacagtat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|259901.1.peg.33 Bacteriophage 77 FIG   Phage phi 11 orf9 protein homolog
fig|320843.3.peg.74 Bacteriophage ROSA FIG   Phage phi 11 orf9 protein homolog
gb|AAR87923.1 Bacteriophage 77     77ORF065
gb|AAX91553.1 Bacteriophage ROSA     ORF074
gb|ABF73235.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gb|ABQ48120.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0313
gb|ABR51184.1 Staphylococcus aureus subsp. aureus JH1     phi PV83 orf 10-like protein
gb|EEV77157.1 Staphylococcus aureus A6300     phage77_ORF065 protein
gb|EEV80536.1 Staphylococcus aureus A6224     phage77_ORF065 protein
gi|104641927 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|147739822 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0313
gi|148266753 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0313
gi|149945248 Staphylococcus aureus subsp. aureus JH1 NCBI   phi PV83 orf 10-like protein
gi|150392796 Staphylococcus aureus subsp. aureus JH1 NCBI   phi PV83 orf 10-like protein
gi|257854204 Staphylococcus aureus A6300 NCBI   phage77_ORF065 protein
gi|257857642 Staphylococcus aureus A6224 NCBI   phage77_ORF065 protein
gi|258447191 Staphylococcus aureus A6300 NCBI   phage77_ORF065 protein
gi|258449093 Staphylococcus aureus A6224 NCBI   phage77_ORF065 protein
gi|40557267 Bacteriophage 77 NCBI   77ORF065
gi|41189566 Staphylococcus phage 77 NCBI   77ORF065
gi|62636442 Bacteriophage ROSA NCBI   ORF074
gi|66396022 Staphylococcus phage ROSA NCBI   ORF074
img|638305511 Bacteriophage 77 IMG   77ORF065
img|638314764 Bacteriophage ROSA IMG   ORF074
img|640564643 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778392 Staphylococcus aureus aureus JH1 IMG   phi PV83 orf 10-like protein
kegg|sah:SaurJH1_0322 Staphylococcus aureus subsp. aureus JH1 KEGG   phi PV83 orf 10-like protein
kegg|saj:SaurJH9_0313 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
ref|NP_958634.1 Staphylococcus phage 77 RefSeq   77ORF065
ref|YP_001245696.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0313
ref|YP_001315471.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   phi PV83 orf 10-like protein
ref|YP_240345.1 Staphylococcus phage ROSA RefSeq   ORF074
ref|ZP_05695341.1 Staphylococcus aureus A6300 RefSeq   phage77_ORF065 protein
ref|ZP_05697200.1 Staphylococcus aureus A6224 RefSeq   phage77_ORF065 protein
tr|A0EX26 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|A5IPJ7 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6TYB6 Staphylococcus aureus (strain JH1) TrEMBL   Phi PV83 orf 10-like protein
tr|Q4ZBN1 Staphylococcus phage ROSA TrEMBL   ORF074
tr|Q6R849 Staphylococcus phage 77 TrEMBL   77ORF065


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search